KEGG   Streptomyces avermitilis: SAVERM_3912
Entry
SAVERM_3912       CDS       T00126                                 
Name
(GenBank) putative ATP-dependent DNA helicase
  KO
K10843  DNA excision repair protein ERCC-3 [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SAVERM_3912
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_3912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_3912
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3912
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_3912
Transcription machinery [BR:sma03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SAVERM_3912
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SAVERM_3912
SSDB
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 Helicase_C ResIII SNF2-rel_dom DEAD IMD YflT ETAA1
Other DBs
NCBI-ProteinID: BAC71624
NITE: SAV3912
UniProt: Q82GI5
Position
4832156..4833799
AA seq 547 aa
MNGPLIVQSDKTLLLEVDHEQANECRRAIAPFAELERAPEHIHTYRVTPLGLWNARAAGH
DAEQVVDALVQYSRYPVPHALLVDIAETMDRYGRLTLSKHPAHGLVLTTTDRPVLEEILR
SKRVAPLVGARLDPDTVAVHPSERGQIKQTLLKLGWPAEDLAGYVDGEAHPIELAEDGWA
LRPYQKQAVENFWHGGSGVVVLPCGAGKTLVGAGSMAQAKATTLILVTNTVSARQWKHEL
VKRTSLTEDEIGEYSGTKKEIRPVTIATYQVLTTRRKGVYPHLELFDSRDWGLIVYDEVH
LLPAPVFKFTADLQARRRLGLTATLVREDGRESDVFSLIGPKRFDAPWKEIEAQGYIAPA
DCVEVRVNLTETERLAYATAETEEKYRFCATTATKRKVTEALVRKFAGQQILVIGQYIDQ
LDELGEHLNAPVIKGETSNAQREKLFDAFREGEISVLVVSKVANFSIDLPEATVAIQVSG
TFGSRQEEAQRLGRVLRPKADGHQAHFYSVVARDTIDQDFAAHRQRFLAEQGYAYRIMDA
DELLTES
NT seq 1644 nt   +upstreamnt  +downstreamnt
gtgaatggtccactcatcgtccagagcgacaagacactcctgctcgaagtcgaccacgag
caggcgaacgagtgccgacgggccatcgcgccgttcgccgagctggagcgggcgcccgag
cacatccacacctaccgggtgaccccgctcgggctgtggaacgcgcgggccgccgggcac
gacgccgagcaggtcgtggacgcgctcgtgcagtacagccggtaccccgtgccgcatgcc
ctgctcgtggacatcgccgagacgatggaccgctacgggcggctgacgctctccaagcac
ccggcccacgggctggtgctcacgacgacggaccggcccgtgctcgaggagatcctccgg
tccaagcgggtcgccccgctcgtcggcgcccgcctcgaccccgacaccgtcgccgtgcac
ccctccgagcgcgggcagatcaagcagacgctgctgaagctgggctggcccgccgaggac
ctcgccggttacgtcgacggggaggcgcacccgatcgagctggccgaggacggctgggcg
ctgcggccgtaccagaagcaggccgtggagaacttctggcacggcggctccggcgtggtc
gtgctgccctgtggcgcgggcaagacgctcgtcggtgccgggtccatggcgcaggccaag
gccaccacgctcatcctcgtcaccaacaccgtctccgcccgccagtggaagcacgagctg
gtgaagcggacgagtctcaccgaggacgagatcggtgagtacagcggtacgaagaaggag
atccggccggtcaccatcgccacgtaccaggtgctgacgaccaggcggaagggcgtctac
ccgcacctggagctgttcgactcccgtgactggggactcatcgtctacgacgaggtgcat
ctgctgccggcgcccgtcttcaagttcaccgccgatctccaggcgcggcggcggctgggg
ctgacggcgaccctcgtgcgggaggacgggcgcgagtcggacgtcttctcgctcatcggg
cccaagcggttcgacgctccgtggaaggagatcgaggcgcaggggtacatcgcgcccgcc
gactgcgtggaggtgcgggtcaatctgacggagaccgagcggctcgcgtacgcgaccgcc
gagaccgaggagaagtatcgcttctgcgccaccacggcgacgaagcggaaggtgacggag
gcgctggtccggaagttcgccgggcagcagatcctcgtcatcggccagtacatcgaccag
ctcgacgagctgggcgagcacctgaacgcgcccgtcatcaagggcgagaccagcaacgcg
cagcgcgagaagctcttcgacgccttccgggagggcgagatcagcgtcctcgtcgtctcc
aaggtcgcgaacttctccatcgacctgccggaggcgaccgtcgccatccaggtgtcgggc
acgttcggctcgcgccaggaggaggcgcagcggctgggccgcgtcctgcggcccaaggcg
gacggccaccaggcccacttctactcggtcgtcgcccgcgacaccatcgaccaggacttc
gccgcgcaccgccagcgcttcctggcggagcagggctacgcctaccggatcatggacgcg
gacgagctcctgacggagagctga

DBGET integrated database retrieval system