KEGG   Streptomyces avermitilis: SAVERM_3931
Entry
SAVERM_3931       CDS       T00126                                 
Symbol
groEL2
Name
(GenBank) putative class I heat-shock protein
  KO
K04077  chaperonin GroEL [EC:5.6.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_3931 (groEL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_3931 (groEL2)
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_3931 (groEL2)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_3931 (groEL2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_3931 (groEL2)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.7  chaperonin ATPase
     SAVERM_3931 (groEL2)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     SAVERM_3931 (groEL2)
Chaperones and folding catalysts [BR:sma03110]
 Heat shock proteins
  HSP60 / Chaperonin
   SAVERM_3931 (groEL2)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    SAVERM_3931 (groEL2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAVERM_3931 (groEL2)
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_3931 (groEL2)
  Exosomal proteins of breast cancer cells
   SAVERM_3931 (groEL2)
  Exosomal proteins of colorectal cancer cells
   SAVERM_3931 (groEL2)
  Exosomal proteins of bladder cancer cells
   SAVERM_3931 (groEL2)
SSDB
Motif
Pfam: Cpn60_TCP1 DUF5021
Other DBs
NCBI-ProteinID: BAC71643
NITE: SAV3931
UniProt: Q82GG6
Position
complement(4854193..4855818)
AA seq 541 aa
MAKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIE
LEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPMALKRGIE
KAVEAVSGALLEQAKDVETKEQIASTASISAADTQIGELIAEAMDKVGKEGVITVEESQT
FGLELELTEGMRFDKGYISAYFATDMERMEASLDDPYILIANSKISSVKDLLPLLEKVMQ
SGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLGDIAILTGGEVIS
EEVGLKLENASIDLLGRARKVVITKDETTIVDGAGSADQVAGRVNQIRAEIENSDSDYDR
EKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALIQA
SSVFEKLELTGDEATGANAVRLALEAPLKQIAVNGGLEGGVIVEKVRNLPVGHGLNAATG
EYVDMIAEGIIDPAKVTRSALQNAASIAALFLTTEAVIADKPEKAAAGGAPGGMPGGDMD
F
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggccaagatcatcgcgttcgacgaggaggcacggcgcggtctcgagcgcgggatgaac
cagctcgccgacgccgtcaaggtcacccttggccccaagggccgcaacgtcgtcctcgag
aagaagtggggcgcccccacgatcaccaacgatggtgtttccatcgccaaggagatcgag
ctcgaggacccgtacgagaagatcggcgccgagctggtcaaggaagtcgccaagaagacg
gacgacgtcgccggtgacggtacgaccaccgcgaccgtcctcgcccaggcgctcgtccgc
gagggcctgcgcaacgtagccgccggcgccaacccgatggctctcaagcgcggtatcgag
aaggccgtcgaggccgtctccggtgccctgctcgagcaggcgaaggatgtcgagaccaag
gagcagatcgcttcgacggcctccatctccgccgccgacacccagatcggcgagctcatc
gccgaggcgatggacaaggtcggcaaggaaggcgtcatcaccgtcgaggagtcccagacc
ttcggtctggagctcgagctcaccgagggtatgcgcttcgacaagggctacatctcggcg
tacttcgccaccgacatggagcgtatggaggcgtcgctcgacgacccgtacatcctgatc
gccaactccaagatcagttccgtcaaggacctgctcccgctcctcgagaaggtcatgcag
tcgggcaagccgctgctgatcatcgccgaggacgtcgagggcgaggccctgtcgaccctg
gtcgtcaacaagatccgtggcaccttcaagtccgtcgccgtcaaggctccgggcttcggt
gaccgccgcaaggccatgctcggcgacatcgccatcctcacgggcggcgaggtcatctcc
gaggaggtcggcctcaagctggagaacgcgagcatcgacctgctcggtcgcgcccgcaag
gtcgtcatcaccaaggacgagaccacgatcgtcgacggcgccggctcggccgaccaggtc
gccggccgggtcaaccagatccgtgccgagatcgagaactccgactcggactacgaccgc
gagaagctccaggagcgtctggcgaagctggccggcggcgtggccgtcatcaaggccggt
gccgccaccgaggtcgagctcaaggagcgcaagcaccgcatcgaggacgccgttcgcaac
gcgaaggcggccgtcgaggagggcatcgtcgccggtggtggcgtggccctcatccaggct
tcctcggtcttcgagaagctggagctcacgggtgacgaggcgaccggcgccaacgccgtg
cggctcgccctggaggccccgctcaagcagatcgccgtcaacggtggtctcgagggtggc
gtcatcgtcgagaaggtgcgcaacctgcccgtcggccacggcctgaacgccgcgaccggt
gagtacgtcgacatgatcgccgaaggcatcatcgacccggcgaaggtcacgcgctctgcc
ctgcagaacgccgcctccatcgccgcgctgttcctgaccaccgaggccgtcatcgccgac
aagccggagaaggccgccgcgggcggcgctccgggcggcatgccgggcggtgacatggac
ttctga

KEGG   Streptomyces avermitilis: SAVERM_4992
Entry
SAVERM_4992       CDS       T00126                                 
Symbol
groEL1
Name
(GenBank) putative class I heat-shock protein
  KO
K04077  chaperonin GroEL [EC:5.6.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_4992 (groEL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_4992 (groEL1)
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_4992 (groEL1)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_4992 (groEL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_4992 (groEL1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.7  chaperonin ATPase
     SAVERM_4992 (groEL1)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     SAVERM_4992 (groEL1)
Chaperones and folding catalysts [BR:sma03110]
 Heat shock proteins
  HSP60 / Chaperonin
   SAVERM_4992 (groEL1)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    SAVERM_4992 (groEL1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAVERM_4992 (groEL1)
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_4992 (groEL1)
  Exosomal proteins of breast cancer cells
   SAVERM_4992 (groEL1)
  Exosomal proteins of colorectal cancer cells
   SAVERM_4992 (groEL1)
  Exosomal proteins of bladder cancer cells
   SAVERM_4992 (groEL1)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-ProteinID: BAC72704
NITE: SAV4992
UniProt: Q82DI5
Position
6040941..6042569
AA seq 542 aa
MAKILKFDEDARRALERGVNKLADTVKVTIGPKGRNVVIDKKFGAPTITNDGVTIAREVE
VEDPYENLGAQLVKEVATKTNDIAGDGTTTATVLAQALVREGLKNVAAGASPALLKKGID
AAVKAVSEELLATARPIDEKSDIAAVAGLSAQDSQVGELIAEAMDKVGKDGVITVEESNT
FGLELDFTEGMAFDKGYLSPYFVTDQERMEAVLEDPYILIHQGKISSIQDLLPLLEKVIQ
ANASKPLLIIAEDVEGEALSTLVVNKIRGTFNAVAVKAPGFGDRRKAMLGDIATLTGGQV
IAEEVGLKLDQVGLDVLGTARRVTVTKDDTTIVDGGGSSDEVAGRINQIKAEIENTDSDW
DREKLQERLAKLAGGVCVIKVGAATEVELKEKKHRLEDAISATRAAVEEGIVSGGGSALV
HAVKVLEGNLGKTGDEATGVAVVRRAAVEPLRWIAENAGLEGYVITSKVAELDKGQGFNA
ATGEYGDLVKSGVIDPVKVTRSALENAASIASLLLTTETLVVEKPAEEEADAGHGHGHGH
SH
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcgaagatcctgaagttcgacgaggacgcccgtcgcgccctcgagcgcggcgtcaac
aagcttgccgacacggtcaaggtgacgatcggccccaagggccgcaacgtcgtcatcgac
aagaagttcggcgcccccaccatcaccaacgacggtgtcaccatcgcccgcgaggtcgag
gtcgaggacccgtacgagaacctcggcgcccagctggtgaaggaggtggcgaccaagacc
aacgacatcgcgggtgacggtacgaccaccgccaccgtgctggcccaggcgctcgtccgc
gagggcctgaagaacgtcgccgccggcgcgtcccccgccctcctgaagaagggcatcgac
gccgcggtcaaggctgtgtccgaggagctcctcgcgaccgcccgcccgatcgacgagaag
tccgacatcgccgccgtcgccggtctgtccgcccaggacagccaggtcggcgagctcatc
gccgaggcgatggacaaggtcggcaaggacggtgtcatcaccgtcgaggagtccaacacc
ttcggtctggagctggacttcaccgagggcatggccttcgacaagggctacctgtcgccg
tacttcgtgacggaccaggagcgcatggaggccgtcctcgaggacccgtacatcctcatc
caccagggcaagatctcctccatccaggacctcctgccgctgctggagaaggtcatccag
gccaacgcctccaagccgctgctgatcatcgccgaggacgtcgagggcgaggcactgtcg
accctggtcgtgaacaagatccgcggcacgttcaacgcggtcgcggtcaaggcccccggc
ttcggtgaccgccgcaaggccatgctcggcgacatcgccaccctcaccggcggtcaggtc
atcgccgaggaggtcggcctcaagctcgaccaggtcggcctggacgtgctgggcaccgcc
cgccgcgtgaccgtcaccaaggacgacaccaccatcgtcgacggtggcggcagctccgac
gaggtcgccggccggatcaaccagatcaaggccgagatcgagaacaccgactccgactgg
gaccgcgagaagctccaggagcgcctcgcgaagctggccggcggcgtgtgcgtcatcaag
gtcggcgccgccaccgaggtggagctgaaggagaagaagcaccgtctggaggacgccatc
tccgcgacccgcgccgcggtcgaggagggcatcgtctccggtggtggctccgcgctcgtc
cacgccgtgaaggtcctggagggcaacctcggcaagaccggcgacgaggccacgggtgtc
gcggtcgtccgccgcgccgccgtcgagccgctgcgctggatcgccgagaacgccggcctc
gagggctacgtcatcacctccaaggtcgccgagctcgacaagggccagggcttcaacgcc
gcgaccggcgagtacggcgacctggtcaagtccggtgtcatcgacccggtcaaggtcacc
cgctccgccctggagaacgccgcgtccatcgcgtccctgctcctgacgaccgagaccctg
gtcgtcgagaagccggcggaagaggaggccgacgcgggccacggccacggtcacggccac
tcgcactga

DBGET integrated database retrieval system