KEGG   Streptomyces avermitilis: SAVERM_4273
Entry
SAVERM_4273       CDS       T00126                                 
Symbol
cysA
Name
(GenBank) putative cystathionine/methionine gamma-synthase/lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00270  Cysteine and methionine metabolism
sma00450  Selenocompound metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_4273 (cysA)
   00270 Cysteine and methionine metabolism
    SAVERM_4273 (cysA)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAVERM_4273 (cysA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_4273 (cysA)
Enzymes [BR:sma01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     SAVERM_4273 (cysA)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_4273 (cysA)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 DUF4350 GDC-P Met_gamma_lyase
Other DBs
NCBI-ProteinID: BAC71985
NITE: SAV4273
UniProt: Q82FH9
Position
5238857..5240002
AA seq 381 aa
MTSGDFVAETGDGTRAVRAGLPDPVKHEPTLPGPVFAAHFHLPGEPTGPYTYGRDENPTW
THLERAIGELEAPGQDGVETLTFASGMAAISAVLFSQLRAGDTVVLPDDGYQVLPLVREQ
LTAYGIEVRTAPTGGDAQLDILDGAKLLWIETPSNPGLDVCDVRRLVAAAHAQGTLVAVD
NTLATPLGQRPLELGADFAVASGTKMLTGHGDILLGYVTGRDAAPMAAVRRWRKIVGAIP
GPMEAWLAHRSLATLQLRADRQNANALAVAEALRGRSEVSGLRYPGLPDDPSHKIASQQM
RRYGCVVSFSLPTRGRAERFLDALTLVDDATSFGGVRSTAERRGRWGGDAVAEGFIRFSA
GAEDPEDLVADVLRALDESAH
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacctcaggagatttcgtcgcggagaccggtgacggcactcgggccgttcgggccggg
ctaccggaccccgtgaagcacgagccgaccctcccaggccccgtcttcgccgcccatttc
catctgcccggcgagcccaccggcccgtacacctacggccgcgacgagaaccccacctgg
acccatctggaacgggcgatcggcgagttggaggcgcccggacaggacggcgtcgagacg
ctgaccttcgcctccggcatggccgccatctccgcggtcctcttctcccagctgcgcgcc
ggcgacaccgtggtcctgcccgacgacggctaccaggtactgccgctggtgcgcgagcag
ctgaccgcgtacggcatcgaggtgcgcaccgcaccgacgggcggcgacgcccagctcgac
atcctcgacggcgcgaagctgctgtggatcgagaccccttcgaacccgggtctcgacgtg
tgcgacgtacggcgcctcgtcgcggcggcccacgcacagggcaccctcgtcgcggtcgac
aacaccctggcgaccccactggggcagcggccgcttgagctgggcgccgacttcgccgtg
gccagcggcaccaagatgctcaccgggcacggagacatcctgctcggatacgtcacgggc
cgcgacgcggcgccgatggccgccgtacggcgctggcgcaagatcgtcggggcgattccg
gggcccatggaggcgtggctcgcgcaccgctcgctggccacactgcaactgcgcgcggac
cggcagaacgccaatgccctcgcggtcgccgaggcgctgcgcggccggtccgaggtgagc
ggactgcgctatcccgggctgcccgacgacccctcgcacaagatcgcctcgcagcagatg
cggcgctacgggtgcgtggtgtcgttttcactgcccacgcgcgggcgtgccgagcgtttt
ctcgacgccctgacactcgtggacgatgcgaccagcttcggcggggtacggtccaccgcc
gagcgacgtggccgctggggcggcgacgcggtggcggagggcttcatccgcttctcggcc
ggagccgaggatccagaggacctggtggcggatgtgctgcgcgcgctcgacgagtcggca
cactga

DBGET integrated database retrieval system