KEGG   Streptomyces avermitilis: SAVERM_4284
Entry
SAVERM_4284       CDS       T00126                                 

Symbol
dnaB
Name
(GenBank) putative replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:5.6.2.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4284 (dnaB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4284 (dnaB)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     SAVERM_4284 (dnaB)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAVERM_4284 (dnaB)
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase AAA_22
Other DBs
NCBI-ProteinID: BAC71996
NITE: SAV4284
UniProt: Q82FG8
Position
complement(5249988..5251463)
AA seq 491 aa
MSLSEPLDDPWADSGPSDRLPASRQRREGGRGRDEQHDRGRDSDAWEGAGSSFERVPPQD
LDAEQSVLGGMLLSKDAIADVVEVLKGHDFYKPAHETIYQAILDIYAKGEPADPITIAAE
LTKRGEITKVGGASYLHTLVQTVPTAANAEYYAEIVHERAVLRRLVEAGTRITQMGYAAD
DDVDEIVNRAQAEIFAVTEQRTTEDYLPLGDIMEGALDEIEAIGSRSGEMTGVPTGFTDL
DQLTNGMHPGQMIIIAARPAMGKSTLALDFARAASIKNNLPSVIFSLEMGRNEIAMRLLS
AEARVALHHMRSGTMTDEDWTRLARRMPDVSAAPLYIDDSPNLSMMEIRAKCRRLKQRND
LKLVIIDYLQLMQSGGKRSESRQQEVSDMSRNLKLLAKELELPVIALSQLNRGPEQRTDK
KPMVSDLRESGSIEQDADMVILLHREDAYEKESPRAGEADIIVGKHRNGPTATITVAFQG
HYSRFVDMAQT
NT seq 1476 nt   +upstreamnt  +downstreamnt
gtgagtctttccgagcctttggacgacccctgggccgacagcggtcccagtgatcgtctg
cctgcctcccgccagcgccgcgaaggtggccggggacgggacgagcagcacgaccgtggt
cgggacagcgacgcatgggagggggcgggctcgtccttcgagcgcgtaccgccccaggac
ctggacgccgagcagtccgtcctcggcggcatgctcctctccaaggatgcgatcgccgac
gtcgtcgaggtcctcaagggccatgacttctacaagccggcgcacgagacgatctaccag
gcgatcctcgacatctacgccaagggcgagccggccgacccgatcaccatcgccgccgag
ctgaccaagcgcggtgagatcacgaaggtcgggggcgcctcctatctgcacaccctcgtc
cagacggttccgacggcggcgaacgccgagtactacgcggagatcgtccacgagcgtgcc
gtgctgcgtcgcctggtcgaggccggcacgcgcatcacgcagatgggttacgcggcggac
gacgacgtcgacgagatcgtcaaccgggcccaggccgagatcttcgcggtcaccgagcag
cgcaccactgaggactatctgccgctcggcgacatcatggagggcgcactcgacgagatc
gaggcgatcggttcgcgatcgggggagatgaccggtgtgcccaccggcttcaccgacctc
gaccagctcaccaacggcatgcatcccggccagatgatcatcattgcggcccgtcccgcc
atgggtaagtcgacgctcgcgctggacttcgcgcgtgccgcctccatcaagaacaacctg
ccgagcgtgatcttctcgctcgaaatggggcgtaacgagatcgcgatgcgtctgctctcg
gccgaggcgcgcgtagccctgcaccacatgcggtccggcacgatgaccgacgaggactgg
acacgactcgcccgccgtatgcccgacgtctcggccgcaccgctctacatcgacgactcc
ccgaacctgtcgatgatggagatccgcgcaaagtgccgccgcctcaagcagcgcaacgat
ctgaagctcgtcatcatcgactacctgcaactgatgcagtcgggcggcaagcggtccgag
agccgccaacaggaagtctcggacatgtcgcgaaacctgaagctgctggccaaggagctg
gagctgccggtgatcgcgctctcgcagctgaaccgtggccccgaacagcgcacggacaag
aagcccatggtctccgacctgcgtgagtccggatccatcgagcaggacgctgacatggtc
atcctgctgcaccgcgaggacgcgtacgagaaggagtctccgcgcgcgggcgaggcggac
atcatcgtgggcaagcaccgtaacggcccgacggccacgatcacggtcgccttccagggc
cactactcacgcttcgtggacatggcccaaacctga

DBGET integrated database retrieval system