KEGG   Streptomyces avermitilis: SAVERM_4296
Entry
SAVERM_4296       CDS       T00126                                 
Symbol
ino1
Name
(GenBank) 1L-myo-inositol-1-phosphate synthase
  KO
K01858  myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00521  Streptomycin biosynthesis
sma00562  Inositol phosphate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SAVERM_4296 (ino1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_4296 (ino1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.4  inositol-3-phosphate synthase
     SAVERM_4296 (ino1)
SSDB
Motif
Pfam: Inos-1-P_synth NAD_binding_5
Other DBs
NCBI-ProteinID: BAC72008
NITE: SAV4296
UniProt: Q82FF7
Position
5263812..5264894
AA seq 360 aa
MGSVRVAIVGVGNCAASLVQGVEYYKDADPASKVPGLMHVQFGEYHVGDVEFVAAFDVDA
KKVGLDLSDAIGASENNTIKICDVPNKGITVQRGHTLDGLGKYYRQTIEESAEAPVDVVQ
ILKDKQVDVLVCYLPVGSEDAAKFYAQCAIDAKVAFVNALPVFIAGTKEWADKFTEAGVP
IVGDDIKSQVGATITHRVMAKLFEDRGVRLERTMQLNVGGNMDFKNMLERDRLESKKISK
TQAVTSQIPDRDLGEKNVHIGPSDYVAWLDDRKWAYVRLEGRAFGDVPLNLEYKLEVWDS
PNSAGVIIDALRAAKIAKDRGIGGPILSASSYFMKSPPVQYFDDEAYANVEKFIKGEVER
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgggttcggttcgcgtagccatcgtcggcgtgggcaactgcgccgcctcgctggtgcag
ggcgtcgagtactacaaggacgccgacccggcgtccaaggtgcccggtctgatgcacgtc
cagttcggcgagtaccacgtcggtgacgtcgagttcgtcgccgccttcgacgtcgacgcg
aagaaggtcggcctcgacctctccgacgccatcggtgccagcgagaacaacaccatcaag
atctgtgacgtcccgaacaagggcatcacggtccagcgcggccacaccctcgacggtctc
ggcaagtactaccgccagaccatcgaggagtccgccgaggccccggtcgacgtcgtccag
atcctcaaggacaagcaggtcgacgtcctcgtctgctacctgcccgtcggttccgaggac
gcggcgaagttctacgcccagtgcgccatcgacgccaaggtcgccttcgtcaacgccctc
ccggtcttcatcgccggcaccaaggagtgggcggacaagttcaccgaggccggcgtcccg
atcgtcggtgacgacatcaagtcgcaggtcggcgccaccatcacgcaccgtgtgatggcg
aagctgttcgaggaccgcggtgtccgtctcgagcgcaccatgcagctcaacgtcggcggc
aacatggacttcaagaacatgctggagcgcgaccgcctcgagtccaagaagatctcgaag
acgcaggccgtcacctcgcagatccccgaccgcgacctgggcgagaagaacgtccacatc
ggtccctcggactacgtggcctggctcgacgaccgcaagtgggcgtacgtccgcctcgag
ggccgtgccttcggtgacgttccgctgaacctggagtacaagctcgaggtctgggactcc
ccgaactccgcgggtgtcatcatcgacgccctgcgcgccgcgaagatcgccaaggaccgc
ggcatcggcggcccgatcctgtcggcgtcttcgtacttcatgaagtctccgccggttcag
tacttcgacgacgaggcctacgccaacgtcgagaagttcatcaagggcgaggtcgagcgc
taa

DBGET integrated database retrieval system