KEGG   Streptomyces avermitilis: SAVERM_4312
Entry
SAVERM_4312       CDS       T00126                                 
Symbol
yidC
Name
(GenBank) putative preprotein translocase YidC subunit
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_4312 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_4312 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_4312 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_4312 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_4312 (yidC)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    SAVERM_4312 (yidC)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_4312 (yidC)
SSDB
Motif
Pfam: 60KD_IMP OSTbeta
Other DBs
NCBI-ProteinID: BAC72024
NITE: SAV4312
UniProt: P59811
Position
complement(5283382..5284668)
AA seq 428 aa
MDTIASLFSFITIPVSWVIVQFHSVYGKVFGADTGWAWGLSIVSLVILIRICLIPLFVKQ
IKATRAMQTLQPEMKKIQERYKNDKQRQSEEMMKLYKESGTNPLSSCLPILAQSPFFFAL
YHVLNGIATGKTIGVIDDQLLASARKAHIFGAPLAAKFTDSADKVTQLGATLMDVRVVTA
IMIVLMSASQFYTQRQLMTKNVDTTVKTPFMQQQKMLMYVFPVMFAIFGINFPVGVLVYW
LTTNVWTMGQQMYVIRNNPTPGSKAQAAFLERLQKHVLHHGKTRSRGQRAVVKAIVAKGR
DRNEFERKFINALTKAGLAAQSDGTIGKGEATAVAETEDGTQTTGGAPRRQQPKRQSKSQ
RQSGSAKAAGESEPKSTPLSLSKSDEPDDAKPAAKPAGGANKPSTGTRSKAQSGQRKGPQ
RPKSPSKK
NT seq 1287 nt   +upstreamnt  +downstreamnt
gtggacacgattgccagcctcttcagcttcatcacgattcccgtttcctgggtcatcgtc
cagttccactcggtgtacgggaaggtcttcggtgccgacacgggctgggcctggggcctg
tccatcgtgtccctggtgatcctgatccgcatctgcctgatcccgctcttcgtgaagcag
atcaaggcgacccgggccatgcagaccctgcagcccgagatgaagaagatccaggagcgc
tacaagaacgacaagcagcgccagtccgaagagatgatgaagctgtacaaggagtcgggt
accaacccgctctcctcgtgccttcccatcctggcgcagtccccgttcttcttcgccctc
taccacgtgctcaacggcatcgcgaccggcaagacgatcggcgtcatcgacgatcagctg
ctggcgagcgcccgtaaggcgcacatcttcggcgccccgctcgcggcgaagttcaccgac
agcgcggacaaggtcactcagctcggcgccaccctgatggacgtccgggtcgtcaccgcg
atcatgatcgtcctgatgtcggcgtcgcagttctacacgcagcgccagctgatgacgaag
aacgtcgacaccacggtgaagacgccgttcatgcagcagcagaagatgctgatgtacgtc
ttcccggtcatgttcgccatcttcggcatcaacttcccggtcggtgtcctcgtctactgg
ctgaccaccaacgtgtggaccatgggccagcagatgtacgtcatccgcaacaacccgact
ccgggctccaaggcccaggccgcgttcctggagcgtctgcagaagcacgtcctgcaccac
ggcaagacccgcagccgcggccagagggccgtcgtcaaggcgatcgtcgccaaggggcgc
gaccgcaacgagttcgagcgcaagttcatcaacgctctgaccaaggcgggcctggcggcc
cagtccgacggcaccatcgggaagggcgaggctaccgccgtcgccgagaccgaggacggt
acgcagacgaccggtggcgctccccggcggcagcagcccaagcggcagagcaagtcccag
cgccagtcgggcagcgcgaaggccgccggcgagtccgagccgaagagcacccctttgtcg
ctgagcaagtccgatgaaccggacgacgccaagcccgccgccaagccggccggcggcgca
aacaagcccagcaccggtacccgcagcaaggcccagtccggacagcgcaagggtccgcag
cggcccaagtccccgtccaagaagtaa

KEGG   Streptomyces avermitilis: SAVERM_5208
Entry
SAVERM_5208       CDS       T00126                                 
Name
(GenBank) putative membrane protein
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_5208
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_5208
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_5208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_5208
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_5208
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    SAVERM_5208
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_5208
SSDB
Motif
Pfam: 60KD_IMP Apolipoprotein
Other DBs
NCBI-ProteinID: BAC72920
NITE: SAV5208
UniProt: Q82CY0
Position
6314034..6314765
AA seq 243 aa
MSVFAGLVEQLADVLQPLFHASAAAAAIVLFTALVRLLVHPLSRASARGQRARARLQPQV
AELRKKHGKNPEKLQKALLELHAEEKVSPLSGCLPGLFQLPAFFLLYHLFSNTTIGGEGN
ELLTHTLFTAPLGDRWADALGDGGPFGTQGLVYLGLFAIVAAVATFNYRRTKRTMAANPL
PVGDGEQQVPGLGAINRFMPLMSFFTLFTVAFVPLAAALYVVTSTTWSAVERAALYPVPE
RSS
NT seq 732 nt   +upstreamnt  +downstreamnt
atgtccgttttcgccggcttggtcgagcaactcgccgacgtgctccagccgctgttccac
gcctccgccgcggcggccgcgatcgtcctgttcaccgcgctcgtacggctcctggtgcac
ccgctgtcccgggcgtcggcgcgtgggcagcgggcgcgggcgaggctccagccgcaggtc
gcggagctgcgcaagaagcacggcaagaaccccgagaagctccagaaggcgctgctggaa
ctgcatgccgaggagaaggtctcgccgctgtccgggtgtctgcccgggctcttccagctc
cccgccttcttcctcctctaccacctgttctcgaacacgacgatcggcggcgaaggcaac
gaactgctgacccacaccctgttcaccgcgcccctcggcgaccgctgggcggacgcgctg
ggcgacggcgggccgttcgggacgcaggggctggtctacctcggcctcttcgcgatcgtc
gcggcggtcgcgaccttcaactaccgccgtacgaagcggacgatggcggcgaacccgctc
ccggtgggcgacggcgagcagcaggtgccggggctgggcgcgatcaacaggttcatgccg
ctgatgtccttcttcacgctcttcaccgtggcgttcgtgccgctggccgccgcgctgtac
gtggtgaccagcacgacgtggagcgcggtcgagcgggcggcgctgtacccggtaccggag
cggtcctcctga

DBGET integrated database retrieval system