KEGG   Streptomyces avermitilis: SAVERM_4551
Entry
SAVERM_4551       CDS       T00126                                 
Name
(GenBank) putative aminotransferase
  KO
K15372  taurine---2-oxoglutarate transaminase [EC:2.6.1.55]
Organism
sma  Streptomyces avermitilis
Pathway
sma00410  beta-Alanine metabolism
sma00430  Taurine and hypotaurine metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_4551
   00430 Taurine and hypotaurine metabolism
    SAVERM_4551
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.55  taurine---2-oxoglutarate transaminase
     SAVERM_4551
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: BAC72263
NITE: SAV4551
UniProt: Q82ER2
Position
complement(5558978..5560333)
AA seq 451 aa
MTPQPNPQVGAAVKAADRAHVFHSWSAQELIDPLAVAGAEGSYFWDYDGRRYLDFTSGLV
FTNIGYQHPKVVAAIQEQAASLTTFAPAFAVEARSEAARLIAERTPGDLDKIFFTNGGAD
AIEHAVRMARIHTGRPKVLSAYRSYHGGTQQAVNITGDPRRWASDSASAGVVHFWAPYLY
RSRFYAETEQQECERALEHLETTIAFEGPGTIAAIVLETVPGTAGIMVPPPGYLAGVREL
CDKYGIVFVLDEVMAGFGRTGEWFAADLFDVTPDLMTFAKGVNSGYVPLGGVAISGKIAE
TFGKRAYPGGLTYSGHPLACAAAVATINVMAEEGVVENAANLGARVIEPGLRELAERHPS
VGEVRGVGMFWALELVKDRETREPLVPYNAAGEANAPMAAFGAAAKANGLWPFINMNRTH
VVPPCNVTEAEAKEGLAALDAALSVADEYTV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgacccctcagccgaatccccaggtcggtgccgccgtcaaggccgcggaccgtgcgcat
gtcttccactcctggtcagcgcaggagctcatcgacccgctcgccgtcgccggtgcggag
gggtcgtacttctgggactacgacggcaggcggtacctggacttcaccagcggactcgtc
ttcaccaacatcgggtaccagcaccccaaggtcgtcgccgccattcaggagcaggccgcg
agcctgaccaccttcgcgcccgccttcgccgtcgaggcgcggtccgaggcggcccggctc
atcgccgagcggacgcccggagacctcgacaagatcttcttcaccaacggcggggccgac
gccatcgagcacgccgtgcgcatggcgcggatacacaccgggcggcccaaggtgctgtcc
gcctaccgctcctaccacggtggcacccagcaggccgtcaacatcaccggtgatccgcgc
cgctgggcctccgacagcgcctcggcgggcgtcgtgcacttctgggcgccgtacctctac
cggtcgcgcttctacgcggagaccgagcagcaggagtgcgagcgggcgctggagcacctg
gagacgaccatcgccttcgaggggccgggcacgatcgccgcgatcgtgctggagaccgtt
ccggggaccgcggggatcatggttccgccgcccggatatctcgccggggtgcgtgagctg
tgcgacaagtacggcatcgtcttcgtcctggacgaggtgatggccgggttcggacggacc
ggtgagtggttcgccgcggatctcttcgacgtcacacccgacctgatgaccttcgccaag
ggcgtgaactccggatatgtgccgctgggcggtgtcgcgatctccgggaagatcgccgag
accttcgggaagcgggcctacccgggcggtctgacctactccgggcatccgctcgcctgc
gccgccgccgtcgccacgatcaacgtcatggccgaggagggggtcgtcgagaacgcggcg
aacctcggcgcccgggtcatcgagccggggctgcgcgagctggccgagcggcacccgtcc
gtgggcgaggtgcgcggtgtcggcatgttctgggcgctggagctggtcaaggaccgggag
acgcgggagccgctggtgccgtacaacgcggcgggcgaggcgaacgcgccgatggccgcc
ttcggtgccgccgccaaggcgaacggcctgtggccgttcatcaacatgaaccgcacgcac
gtcgtgcccccgtgcaacgtcacggaggccgaggccaaggaaggcctggcggccctcgac
gcggccctctcggtggcggacgagtacacggtttag

DBGET integrated database retrieval system