KEGG   Streptomyces avermitilis: SAVERM_4557
Entry
SAVERM_4557       CDS       T00126                                 
Symbol
recR
Name
(GenBank) putative recombination and repair protein
  KO
K06187  recombination protein RecR
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_4557 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4557 (recR)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SAVERM_4557 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAVERM_4557 (recR)
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 DZR HHH_8
Other DBs
NCBI-ProteinID: BAC72269
NITE: SAV4557
UniProt: Q82EQ7
Position
5565399..5565998
AA seq 199 aa
MYEGVVQDLIDELGRLPGVGPKSAQRIAFHILQAEPTDVRRLAQCLMEVKAKVRFCATCG
NVAQEELCNICRDPRRDLSVICVVEEPKDVVAIERTREFRGKYHVLGGAISPIEGVGPDD
LRIRELLARLADGTVTELILATDPNLEGEATATYLARMIKPMGLKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt   +upstreamnt  +downstreamnt
ttgtacgaaggcgtggtccaggacctcatcgacgagctggggcggctgcccggcgtcggt
cccaagagcgcgcagcggatcgccttccacatccttcaggccgagccgacggacgtccgc
cgcctcgcgcagtgcctgatggaggtcaaggcgaaggtccgcttctgcgcgacctgcggg
aacgtggcgcaggaagagctgtgcaacatctgccgcgacccgcgccgcgacctgtccgtc
atctgcgtggtcgaggagcccaaggacgtcgtcgcgatcgagcgcacgcgcgagttccgc
ggcaagtaccacgtgctcggcggcgcgatcagcccgatcgagggtgtggggccggacgac
ctgcggataagggagctgctggcgcgtctcgcggacggcacggtgacggagctgatcctg
gccaccgacccgaacctggagggcgaggccacggcgacgtatctcgcccgcatgatcaag
cccatgggcctcaaggtcacccgcctggccagcggcctccctgtgggtggcgacctggaa
tacgcggacgaggtgaccctcgggcgcgccttcgaggggagacgactcctagatgtctga

DBGET integrated database retrieval system