KEGG   Streptomyces avermitilis: SAVERM_4559
Entry
SAVERM_4559       CDS       T00126                                 
Symbol
lysC
Name
(GenBank) putative aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00261  Monobactam biosynthesis
sma00270  Cysteine and methionine metabolism
sma00300  Lysine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
sma_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_4559 (lysC)
   00270 Cysteine and methionine metabolism
    SAVERM_4559 (lysC)
   00300 Lysine biosynthesis
    SAVERM_4559 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SAVERM_4559 (lysC)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     SAVERM_4559 (lysC)
SSDB
Motif
Pfam: AA_kinase ACT ACT_7 DUF1131
Other DBs
NCBI-ProteinID: BAC72271
NITE: SAV4559
UniProt: Q82EQ5
Position
5567003..5568295
AA seq 430 aa
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGHQVVVVVSAMGDTTDELIDLAEQVSPM
PSGREFDMLLTAGERISMALLAMAIKNLGHSAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTALDEGNIAIVAGFQGVSQDKKDITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
TADPRVVKKAKKIDWIAFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSNTPLVQKAQQQGEQKVEQAIISGVAHDTSEAKVTVVGVPDKPGEAASIFRAIADAEVN
IDMVVQNVSAASTGLTDISFTLPKTEGRKAIDALEKAKSVIGFDSLRYDDQIGKISLVGA
GMKTNPGVTAGFFEALSDAGVNIELISTSEIRISVVTRADDVPEAVRAVHTAFGLDSDSD
EAVVYGGTGR
NT seq 1293 nt   +upstreamnt  +downstreamnt
gtgggccttgtcgtgcagaagtacggaggctcctccgtagccgatgccgaaggcatcaag
cgcgtcgccaagcgaatcgtggaagcgaagaagaacggccaccaggtggtcgtggtcgtt
tccgcgatgggcgacacgacggacgagctgatcgatctcgccgagcaggtatctccgatg
cccagcgggcgagagttcgacatgctgctgaccgccggagagcggatctccatggccttg
ctggcgatggcgatcaaaaacctgggccacagcgcccagagcttcaccggcagccaggca
ggcgtcatcaccgactcggtccacaacaaagcgcggatcatcgatgtcacgccgggccgc
atccggaccgcgctcgacgagggcaacatcgccatcgtcgccgggttccagggcgtcagc
caggacaagaaggacatcaccacgctcggccgcggcggctccgacacgaccgccgtcgcc
cttgccgccgccctcgacgccgaggtctgcgagatctacaccgacgtggacggcgtgttc
accgccgacccgcgcgtggtgaagaaggcgaagaagatcgactggatcgccttcgaggac
atgctggagctcgccgcctccggctccaaggtgctgctccaccgctgtgtggagtacgcc
cgccgttacaacatcccgatccacgtgcgctcgtccttcagcggacttcagggcacctgg
gtcagtaacacgccactcgttcaaaaggcacagcagcaaggggaacagaaggtggagcag
gccatcatttccggtgtcgctcacgacacctcagaggccaaggtcacggtcgtcggcgtc
ccggacaagccgggcgaggccgcctcgatcttccgcgccatcgccgatgccgaagtcaac
atcgacatggtcgtgcagaacgtgtccgccgcctccacgggcctgacggacatctccttc
acgctcccgaagaccgagggccgcaaggccatcgacgcgctggagaaggccaagtcggtc
atcggcttcgactccctgcgctacgacgaccagatcggcaagatctccctggtcggcgcc
ggcatgaagaccaacccgggcgtgaccgccgggttcttcgaggcgctgtccgacgcgggc
gtgaacatcgagctgatctcgacctccgagatccgtatctcggtcgtcacgcgtgccgac
gacgtccccgaggccgtccgcgccgtgcacaccgccttcgggctggactccgacagtgac
gaggccgtggtctacgggggcacgggccgctga

DBGET integrated database retrieval system