KEGG   Streptomyces avermitilis: SAVERM_4560
Entry
SAVERM_4560       CDS       T00126                                 
Symbol
asd1
Name
(GenBank) putative aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00261  Monobactam biosynthesis
sma00270  Cysteine and methionine metabolism
sma00300  Lysine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
sma_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_4560 (asd1)
   00270 Cysteine and methionine metabolism
    SAVERM_4560 (asd1)
   00300 Lysine biosynthesis
    SAVERM_4560 (asd1)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SAVERM_4560 (asd1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SAVERM_4560 (asd1)
SSDB
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh Sacchrp_dh_NADP DXP_reductoisom
Other DBs
NCBI-ProteinID: BAC72272
NITE: SAV4560
UniProt: Q82EQ4
Position
5568295..5569371
AA seq 358 aa
MDRTGPRAGRPTLAVVGATGAVGTVMLQILSQHADIWGEIRLIASPRSAGRKLAVRGEEV
EVMALTEAAFDGVDVAMFDVPDEVAAQWAPIAAAKGTVVVDNSGAFRMDPDVPLVVPEVN
PHAVRMRPRGIIANPNCTTLSMIVALGALHAEFGLRELVVSSYQAVSGAGRAGVETLRQQ
MSLVAGTQLGTSPGDVRRAVGDNTGPFPEPVALNVVPWAGSLREDGWSSEEMKVRDESRK
ILGLPQLRVAVTCVRVPVVTTHSLTVHARFEGEVTVDKAREILATAPGVVLFDDPAAGEF
PTPADVVGTDPTWVGRVRRALDDPTALELFVCGDNLRKGAALNTAQIAELVARELTGA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggaccgcaccgggccgcgagccgggaggccgacgctcgcggtggtgggagcgaccggc
gccgtcggcaccgtcatgctccagatcctgtcgcagcacgcggacatctggggcgagatc
cgcctgatcgcctccccgcgctcggccggccgcaagctggccgtgcgcggcgaggaggtc
gaggtcatggccctgaccgaggccgccttcgacggcgtcgacgtggcgatgttcgacgtg
ccggacgaggtcgccgcgcagtgggcacccatcgcggcggccaagggcacggtcgtcgtc
gacaactccggcgccttccggatggaccccgacgtgcccctcgtcgtacccgaggtcaat
ccccacgcggtacgtatgcgcccgcgcgggatcatcgccaaccccaactgcacgaccctc
tcgatgatcgtggcgctcggcgcgctgcacgccgagttcgggctgcgcgaattggtggtg
tccagctatcaggcggtgagcggcgccggacgcgcgggcgtcgagacgctgcggcagcag
atgtccctggtcgccggtacgcaactggggaccagccccggtgacgtacgacgggccgtg
ggcgacaacaccggtcccttcccggagccggtcgcgctgaacgtcgtgccgtgggccgga
tcgctgcgcgaggacggctggtcctcggaggagatgaaggtacgcgacgagtcccgcaag
atcctcgggctgccccagctgcgcgtcgccgtcacctgcgtccgggtgccggtggtcacc
acgcactcgctcaccgtccacgcccgcttcgagggcgaggtcaccgtcgacaaggcccgc
gagatcctcgccaccgcacccggcgtcgtcctcttcgacgacccggccgccggcgagttc
ccgacccccgccgacgtggtgggcaccgacccgacctgggtgggccgcgtacgccgcgcg
ctcgacgacccgacggcactcgaactgttcgtctgcggggacaacctgcgcaagggcgcc
gctctgaacaccgcgcagatcgcggagctggtggcgagggagctgacgggggcgtaa

KEGG   Streptomyces avermitilis: SAVERM_5397
Entry
SAVERM_5397       CDS       T00126                                 
Symbol
asd2
Name
(GenBank) putative aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00261  Monobactam biosynthesis
sma00270  Cysteine and methionine metabolism
sma00300  Lysine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
sma_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_5397 (asd2)
   00270 Cysteine and methionine metabolism
    SAVERM_5397 (asd2)
   00300 Lysine biosynthesis
    SAVERM_5397 (asd2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SAVERM_5397 (asd2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SAVERM_5397 (asd2)
SSDB
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh S4 Gp_dh_C NAD_binding_10
Other DBs
NCBI-ProteinID: BAC73109
NITE: SAV5397
UniProt: Q82CF3
Position
complement(6543990..6545006)
AA seq 338 aa
MRVGIVGATGQVGTVMRRILVERDFPVTELRLFASARSAGSVVDGVTVEDASTADYTGLD
IVLFSAGGATSRALCEKVAAQGAVVIDNSSAWRKDPAVPLVVAEVNPHAIADRPKGIIAN
PNCTTMAAMPVLKPLHEEAGLEALIVATYQAVSGSGVAGVAELHGQAQKVIADADKLTHD
GEAVDYPEPQVYQRPIAFNVVPLAGSLVDDGLHETDEEQKLRNESRKILEIPALKVSGTC
VRVPVFSGHSLQVNARFARPLSVERATELLGGAPGVALSEIPTPLEAAGKDPSFVGRIRA
DETVDNGLALFISNDNLRKGAALNAVQIAELVAAELKG
NT seq 1017 nt   +upstreamnt  +downstreamnt
gtgagggtcggaatcgtcggagccaccggtcaggtcggcacggtcatgcgcaggatcctc
gtggagcgggactttccggtcaccgagctgcgcctgttcgcctcggcccgctcggccggg
tcggtcgtcgacggtgtgacggtggaggacgcctccacggccgactacacgggcctggac
atcgtgctcttctccgcgggcggcgccacgtccagggcgctgtgcgagaaggtcgccgcc
cagggcgcggtcgtgatcgacaactcttcggcgtggcggaaggacccggccgtacccctg
gtggtcgccgaggtgaacccgcacgcgatcgcggaccgccccaagggcatcatcgccaac
ccgaactgcacgacgatggccgcgatgccggtgctgaagccgctgcacgaggaggcgggc
ctcgaagcgctgatcgtcgccacctaccaggcggtgtccggttccggcgtcgcgggcgtg
gcggagctgcacggccaggcgcagaaggtgatcgccgacgcggacaagctcacgcacgac
ggcgaggcggtcgactaccccgaaccgcaggtctaccagcgcccgatcgccttcaacgtc
gtgcccctcgccggctccctcgtcgacgacggtctgcacgagaccgacgaggagcagaag
ctccgcaacgagtcccgcaagatcctggagatcccggccctcaaggtctccggcacctgc
gtccgcgtcccggtcttctccggccactccctccaggtcaacgcccgcttcgcgcgtccg
ctgtccgtggagcgcgcgacggagctgctgggcggcgcgccgggcgtggccctctcggag
atcccgacgcccctggaggcggccggcaaggacccctcgttcgtgggccgcatccgcgcg
gacgagaccgtcgacaacggcctcgcgctgttcatctccaacgacaacctccgcaagggc
gccgcgctgaacgccgtacagatcgcggagctggtggcggccgagctgaagggctga

DBGET integrated database retrieval system