KEGG   Streptomyces avermitilis: SAVERM_4593
Entry
SAVERM_4593       CDS       T00126                                 
Symbol
nth
Name
(GenBank) putative endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_4593 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4593 (nth)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SAVERM_4593 (nth)
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_4593 (nth)
 Prokaryotic type
     SAVERM_4593 (nth)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S HHH_5
Other DBs
NCBI-ProteinID: BAC72305
NITE: SAV4593
UniProt: Q82EM1
Position
5607216..5608148
AA seq 310 aa
MKKAARKTVKKAAKKATTAVKKDASADPVAKAPKSVAAKPPKSAAKPPRNESRTALVRRA
RRINRELAEVYPYAHPELDFENSFQLILATVLSAQTTDLRVNQTTPALFAKYPTPEDLAA
ANPEEVEEILRPTGFFRAKTKSVIGLSKALVEEFGGEVPGRLEDLVKLPGVGRKTAFVVL
GNAFGRPGITVDTHFQRLVRRWQWTDEKDPDKIEAAVGALFPKSEWTMLSHHVIFHGRRI
CHARKPACGACPIAPLCPAYGEGETDPEKAKKLLKYEKGGFPGQRLNPPQAYLDAGGIPA
PPLGAPQGTP
NT seq 933 nt   +upstreamnt  +downstreamnt
gtgaagaaggcagcccggaagacagtcaagaaggcggccaagaaggcgacgacggccgtg
aagaaggacgcgtccgcggaccccgtcgccaaggcgcccaagtccgtggccgccaagccg
cccaagtccgccgccaagccgcccaggaacgagtcgcgcaccgccctcgtccgccgcgcc
cgccggatcaaccgcgagctcgccgaggtgtacccgtacgcacacccggagttggacttc
gagaactccttccagctgatcttggcgaccgtcctgtccgcgcagaccaccgacctgcgg
gtgaaccagacgacgccggcgctgttcgccaagtacccgaccccggaggacctggccgcg
gccaaccccgaggaggtcgaggagatcctccggcccaccggcttcttccgggccaagacc
aagtcggtcatagggctgtccaaggccctcgtggaggagttcggcggcgaggtccccggg
cgcctcgaagatctcgtcaagctgcccggcgtaggacgcaagacggccttcgtggtgctc
ggcaacgccttcgggcggcccggcatcaccgtggacacccatttccagcggctcgtccgc
cgctggcagtggaccgacgagaaggatccggacaagatcgaggcggccgtcggcgcgctc
ttcccgaagagcgagtggacgatgctctcgcaccatgtgatcttccacggccgccgcatc
tgtcacgcccgcaagccggcctgcggggcctgccccatcgccccgctctgcccggcgtac
ggggagggcgagaccgaccccgagaaggcgaagaagctcctgaagtacgagaagggcggc
ttccccggccagcggctcaatcccccacaggcgtacctggacgcgggcggcatcccggcg
ccgcccctgggagcgccccagggcaccccatga

DBGET integrated database retrieval system