KEGG   Streptomyces avermitilis: SAVERM_4687
Entry
SAVERM_4687       CDS       T00126                                 
Symbol
panC
Name
(GenBank) putative pantoate--beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00410  beta-Alanine metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01240  Biosynthesis of cofactors
Module
sma_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_4687 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_4687 (panC)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     SAVERM_4687 (panC)
SSDB
Motif
Pfam: Pantoate_ligase FAD_syn
Other DBs
NCBI-ProteinID: BAC72399
NITE: SAV4687
UniProt: Q82EC8
Position
5713136..5714137
AA seq 333 aa
MTTTLLRTADELHARVRHGRRAVVMTMGALHEGHATLIRTAREIAGAEGEVVVTVFVNPL
QFGRGEDLDRYPRTLDADLKIAEAAGADVVFAPSADEVYPGGEPQVRISAGPMGERLEGA
FRPGHFDGMLTVVGKLLHLTRPDVALYGQKDAQQLALIRRMARDLNFGVEIVGVPTVRED
DGLALSSRNRYLAADERRTALALSQALFAGRDRHAAQEALRARAREVPATRARAEALSAI
GESRAAADAHAVAKATPAGTSGPAAVRCAARLVLEEAARLQPPLVLDYLGLVDPSDFTEI
PDDFTGEAVLAVAARVGTTRLIDNIPLTFGAAS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaccaccaccctgctgcgcaccgccgacgaactgcacgcgcgtgtgcgccacggccgc
cgggccgtcgtgatgaccatgggcgccctccatgagggtcacgcgaccctgatccgcacc
gcccgcgagatcgccggggccgagggcgaagtcgtcgtcaccgtcttcgtgaaccccctc
cagttcggccggggcgaagacctcgaccgctacccgcgcaccctcgacgccgacctcaag
atcgccgaggcggcgggtgccgacgtcgtgttcgccccgtccgcggacgaggtctacccc
ggcggcgaaccccaggtgcgcatctccgcgggccccatgggcgagcgcctcgaaggagcc
tttcgccccggtcacttcgacggcatgctcaccgtcgtcggcaagctgctgcacctcacc
cgccccgacgtggcgctgtacgggcagaaggacgcccagcagctcgccctgatccgccgc
atggcgcgcgacctcaacttcggcgtggagatcgtcggcgtgcccaccgtgcgcgaggac
gacggcctggccctgtccagccgcaaccgctacctcgccgccgacgagcgccgcaccgca
ctcgcgctctcccaggcgctgttcgccggccgcgaccggcacgccgcccaggaggcgctg
cgcgcgcgggcccgcgaagtgcccgccacgcgcgcgcgtgccgaggccctcagcgccata
ggggagtcccgcgccgccgccgacgcgcacgcggtcgccaaggcgacccccgcgggcacc
tcggggcccgccgccgtccggtgcgccgcccgcctcgtgctggaggaagccgcccggctg
cagccgccgctggtcctcgactacctgggcctggtcgacccctcggacttcaccgagatt
cccgacgacttcaccggcgaggcggtcctcgccgtcgccgcccgggtcgggacgacccgg
ctgatcgacaacattcccctcaccttcggagccgcctcgtga

DBGET integrated database retrieval system