KEGG   Streptomyces avermitilis: SAVERM_4707
Entry
SAVERM_4707       CDS       T00126                                 
Symbol
mutY
Name
(GenBank) putative A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_4707 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4707 (mutY)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     SAVERM_4707 (mutY)
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_4707 (mutY)
 Prokaryotic type
     SAVERM_4707 (mutY)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: BAC72419
NITE: SAV4707
UniProt: Q82EA8
Position
complement(5735621..5736562)
AA seq 313 aa
MTAPTKPTPSQSPSPTSPAPGAPGEALHAQVIAWFDEHARDLPWRRPDAGPWGVMVSEFM
LQQTPVNRVLPVYEQWLARWPRPADLAKEAPGEAVRAWGRLGYPRRALRLHGAAVAITER
HNGDVPTEHAQLLALPGIGEYTAAAVASFAYGQRHAVLDTNVRRVFARAVTGVQYPPNAT
TAAERKLARALLPEDESTASRWAAASMELGALVCTAKNETCHRCPIAGQCAWRLAGKPEH
DGPPRRGQTYAGTDRQVRGRLLAVLREAVTPVPQSALDRVWDEPVQRARALDGLVADGLV
EPLPGGLYRLPHS
NT seq 942 nt   +upstreamnt  +downstreamnt
atgactgcacccacgaagcccacgccaagccaaagcccgagccccacctcccccgccccc
ggcgccccaggcgaggccctgcacgcccaggtcatcgcatggttcgacgagcacgcccgt
gacctcccgtggcgccgccccgacgccggcccctggggcgtgatggtcagtgagttcatg
ttgcagcagacaccggtcaaccgcgtgctgcccgtctacgagcagtggctcgcccgctgg
ccccgccccgccgacctcgccaaggaggcgcccggcgaagccgtccgcgcctggggccgc
ctcggctacccccggcgcgcgctgcgcctgcacggcgccgccgtcgccataacggaacgc
cacaacggcgacgtacccacggagcacgcccagctgctcgcgctgcccggcatcggcgaa
tacaccgccgcggccgtcgcgtcgttcgcctacggccagcgccacgccgttctcgacacc
aacgtccgccgtgtcttcgcccgcgccgtcaccggtgtgcagtacccgcccaacgccacc
accgcagccgagcgcaagctcgcccgcgcgctgctccccgaggacgagagcaccgcgtcc
cgctgggccgccgcgtccatggagctcggcgcgctggtctgcacggcgaagaacgagacc
tgccaccgctgcccgatcgccggccagtgcgcctggcgactcgcgggcaagcccgagcac
gacgggccgccgcgccgcggccagacgtacgccggtacggaccgtcaggtccgcggcagg
ctcctcgccgtcctgcgggaagccgtgaccccggttccgcagtcggcgctcgaccgcgtg
tgggacgagccggtgcagcgcgcccgcgccctggacggcctggtcgccgacggcctcgtc
gagcccctccccggcggcctctaccgcctcccccacagctga

DBGET integrated database retrieval system