KEGG   Streptomyces avermitilis: SAVERM_4811
Entry
SAVERM_4811       CDS       T00126                                 
Symbol
ubiD
Name
(GenBank) putative 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sma  Streptomyces avermitilis
Pathway
sma00130  Ubiquinone and other terpenoid-quinone biosynthesis
sma00627  Aminobenzoate degradation
sma00740  Riboflavin metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
sma01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAVERM_4811 (ubiD)
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAVERM_4811 (ubiD)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_4811 (ubiD)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAVERM_4811 (ubiD)
Enzymes [BR:sma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SAVERM_4811 (ubiD)
SSDB
Motif
Pfam: Flavoprotein HTH_Tnp_1 FdhE
Other DBs
NCBI-ProteinID: BAC72523
NITE: SAV4811
UniProt: Q82E05
Position
5852782..5853447
AA seq 221 aa
MPWIVGVSGASGTPYAAAVLRALVERGESVDLVVSRASRLTLLDETGLPFRDAHWRDDLR
AWLARGADGKPDTFDAFEDHLDAVRHWSAGDLAAGPSSGSYPSKGMLIVPASTACVAGVA
LGLSKDLLQRAASVTLKEGRKLVVAVRETPLNGQTLRHLVSLDEAGATVLPASPAFYAGA
THIQDLVDFVAGRVLDAAGVEHHLYRRWEGELGGGSRGGTT
NT seq 666 nt   +upstreamnt  +downstreamnt
gtgccttggatcgtaggggtgtccggtgcatccggtacgccgtacgccgccgcggtgctg
cgggcgcttgtggagcggggagagagcgtcgacctggtcgtcagcagggcctcccggctc
acgctgctcgacgagaccggtctgcccttccgggacgcccactggcgggacgatctgcgg
gcgtggctggcgcggggcgccgacgggaagccggacaccttcgacgccttcgaggaccat
ctcgacgccgtacggcactggagcgccggtgacctggcagcggggccgtcctccggttcg
tacccctcgaagggcatgctcatcgtgcccgcctccacggcctgcgtcgccggagtcgcc
ctcggcctgtcgaaggacctgttgcagcgcgccgcgagcgtgacgctcaaggaggggcgc
aagctggtcgtcgccgtgcgggagaccccgctgaacgggcagacgctgcggcacctggtc
tccctggacgaggcgggcgccaccgtgctgcccgcctcgccggcgttctacgcgggggcc
acgcacatccaggacctggtggacttcgtcgccgggcgggtgctcgacgcggcgggcgtc
gagcaccacctgtaccgccggtgggagggcgaactcggcggcggctcccgcggcggcacc
acctga

DBGET integrated database retrieval system