KEGG   Streptomyces avermitilis: SAVERM_4858
Entry
SAVERM_4858       CDS       T00126                                 
Symbol
fahA
Name
(GenBank) putative fumarylacetoacetase
  KO
K01555  fumarylacetoacetase [EC:3.7.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00350  Tyrosine metabolism
sma00643  Styrene degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_4858 (fahA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SAVERM_4858 (fahA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_4858 (fahA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.2  fumarylacetoacetase
     SAVERM_4858 (fahA)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_4858 (fahA)
SSDB
Motif
Pfam: FAA_hydrolase FAA_hydrolase_N
Other DBs
NCBI-ProteinID: BAC72570
NITE: SAV4858
UniProt: Q82DW0
Position
complement(5906169..5907392)
AA seq 407 aa
MPPFDVPEGDPFGPHNLPYGVFSPAGSGEQADRSVGVRLGDHVLDAGAAARALGSPYASL
LARPTLNALLAAGRTAWSDVRRAITAWVTVPAHQEAVAPFLHPLSSVTLHLPFEVADYVD
FYASENHARNVGQIFRPDAPDPLTPNWKHLPIGYHGRSGTVVVSGTEVVRPSGQRKAPTD
AAPVFGPSVRLDIEAEVGFVVGTPSPMGRSVGLGDFRDHVFGLCLLNDWSARDIQAWEYV
PLGPFLGKSFATSVSAWITPLDALEDARVAPPARTYPLLPYLDDADEEPGGYDLRISVRI
NGHTVSEPPFSTMYWTAAQQLAHMTVNGASLRTGDLYGSGTVSGPQENQRGSLLELTWNG
RDALELPDGKRTFVEDGDVVTLTAWAPGPDGTRVGLGEVTGRVVPTV
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgccccccttcgatgtccccgagggcgatcccttcggcccgcacaatcttccgtacggc
gtgttctccccggcgggctccggcgagcaggccgaccggagcgtgggcgtccggctcggc
gaccacgtgctcgacgcgggcgcggcagcccgcgcactcggctccccgtacgcctccctg
ctggcgcggccgaccctcaacgcgctcctcgcggcgggccgcacggcatggtcggacgtg
cggcgcgcgatcacggcgtgggtgacggtccccgcccaccaggaggccgtcgcaccgttc
ctgcatccgctctcctcggtgaccctgcacctgcccttcgaggtcgccgactacgtcgac
ttctacgcctccgagaaccacgcgcgaaacgtcgggcagatcttccgcccggacgcgccc
gaccccctgacccccaactggaagcatctgccgatcggctaccacggccgctccggcacg
gtggtggtgtcgggcacggaggtcgtacgcccgtccggccagcgcaaggcccccacggac
gcggcgcccgtcttcggcccttcggtccggctggacatcgaggcggaggtcggcttcgtg
gtgggtacgccgtcgccgatgggccggtcggtgggcctcggcgacttccgggaccacgtc
ttcgggctgtgcctgttgaacgactggtcggcgcgcgacatccaggcctgggagtacgtc
ccgctgggcccgttcctcggcaagtcgttcgccacgtcggtgtcggcgtggatcacccca
ctggacgcgctggaggacgcgcgggtggcgcccccggcgcgcacctacccgctgctgccc
tatctggacgacgcggacgaggagccgggcggctacgacctgcgcatctccgtccggatc
aacggtcatacggtctcggagccgccgttctccaccatgtactggacggccgcgcagcag
ctcgcgcacatgacggtgaacggggcgtcgctgcggacgggcgacctgtacggctcgggc
acggtgagcggccctcaggagaaccagcgcggctccctcctcgagctgacctggaacggc
cgggacgccctcgaactccccgacggcaagcggacgttcgtggaggacggggatgtcgtg
acgctgacggcgtgggcaccggggccggacgggacgcgggtgggcctcggcgaggtcacc
ggccgcgtggtgccgaccgtctga

DBGET integrated database retrieval system