KEGG   Streptomyces avermitilis: SAVERM_4876
Entry
SAVERM_4876       CDS       T00126                                 
Symbol
korB
Name
(GenBank) putative 2-oxoglutarate ferredoxin oxidoreductase, beta subunit
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4876 (korB)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4876 (korB)
   00620 Pyruvate metabolism
    SAVERM_4876 (korB)
   00650 Butanoate metabolism
    SAVERM_4876 (korB)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     SAVERM_4876 (korB)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     SAVERM_4876 (korB)
SSDB
Motif
Pfam: TPP_enzyme_C
Other DBs
NCBI-ProteinID: BAC72588
NITE: SAV4876
UniProt: Q82DU2
Position
complement(5927459..5928538)
AA seq 359 aa
MTETSTEGTGTIEALSLVPKAEARQSMKDFKSDQEVRWCPGCGDYAVLAAVQGFMPELGL
AKENIVFVSGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLASSRRDLSVWVVTGDGDALS
IGGNHLIHALRRNVNLKILLFNNRIYGLTKGQYSPTSEVGKITKSTPMGSLDAPFNPVSL
AIGAEASFVARTVDSDRKHLTDVLRQAAAHPGTALVEIYQNCNIFNDGAFEVLKDKQQAE
EAVIRLEHGKQIRFGADAAKGVVRDPLTGDLKVVTVTPENEARILVHDAHSASPTTAFAL
SRLADPDTLHHTPIGVFRAAERPVYDAQMSEQLDTAIEQNGKGDLAALLAGGDTWTVVG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactgagacgtccacggaaggcacgggcacgatcgaggcgctttccctggtccccaag
gccgaggccaggcagtccatgaaggacttcaagtccgatcaggaagtgcgctggtgcccc
ggctgcggtgactacgcggtcctggccgccgtgcagggcttcatgcccgagctcgggctc
gccaaggagaacatcgtcttcgtctcgggcatcggctgctcgtcccgcttcccgtactac
atgaacacgtacggcatgcactccatccacggccgcgcccccgccatcgccacgggcctc
gcctcctcccgccgcgacctgtcggtctgggtggtcacgggtgacggcgacgcgctgtcc
atcggcggcaaccacctcatccacgccctgcgccgcaatgtgaacctcaagatcctgctg
ttcaacaaccggatctacggcctcaccaagggccagtactcccccacctcggaggtcggc
aagatcaccaagtcgacgccgatgggctcgctggacgcgcccttcaacccggtgtcgctc
gccatcggcgcggaggcgtcgttcgtggcgcggacggtggactccgaccgcaagcatctg
acggacgtgctgcgccaggcggccgcccaccccggcacggcgctggtggagatctaccag
aactgcaacatcttcaacgacggcgccttcgaggtcctcaaggacaaacagcaggccgaa
gaggccgtgatccggctggagcacgggaagcagatccgcttcggcgcggacgccgccaag
ggtgtcgtacgcgacccgctgaccggcgacctgaaggtcgtcaccgtgaccccggagaac
gaggcgcggatcctggtccacgacgcgcactccgcgtccccgaccacggccttcgccctc
tcccgcctcgccgacccggacaccctgcaccacaccccgatcggtgtgttccgtgccgcg
gagcggccggtctacgacgcgcagatgtccgagcagctggacacggcgatcgagcagaac
ggcaagggcgacctggccgcgctgctcgcgggcggggacacctggacggtcgtcggctga

KEGG   Streptomyces avermitilis: SAVERM_4877
Entry
SAVERM_4877       CDS       T00126                                 
Symbol
korA
Name
(GenBank) putative 2-oxoglutarate ferredoxin oxidoreductase, alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4877 (korA)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4877 (korA)
   00620 Pyruvate metabolism
    SAVERM_4877 (korA)
   00650 Butanoate metabolism
    SAVERM_4877 (korA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     SAVERM_4877 (korA)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     SAVERM_4877 (korA)
SSDB
Motif
Pfam: POR_N POR PFOR_II TPP_enzyme_N
Other DBs
NCBI-ProteinID: BAC72589
NITE: SAV4877
UniProt: Q82DU1
Position
complement(5928531..5930459)
AA seq 642 aa
MTSQVSSTTEQADEPVVGEQRKPAGAKDVRRLDRVIIRFAGDSGDGMQLTGDRFTSETAS
FGNDLSTLPNFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLVAMNPAALKANVS
DLPRGAEVIVNTDEFTKRAMQKVGYGTSPLEDGSLDGYSVHPVPLTTLTVEALKEFELSR
KEAERSKNMFALGLLSWMYHRPTEGTEKFLTTKFAKKPAIAAANIAAFRAGWNFGETTED
FAVSYEVAPAQSAFPAGTYRNISGNLALSYGLIAASRQADLPLYLGSYPITPASDILHEL
SKHKNFGVRTFQAEDEIAGIGAALGAAFGGSLAVTTTSGPGVALKSETIGLAVSLELPLL
VVDIQRGGPSTGLPTKTEQADLLQAMYGRNGEAPVPVVAPRTPADCFEAAIEAARIALTY
RTPVFLLSDGYLANGSEPWRIPETDGLPDLRVRFAQGPNHTLDDGTEVFWPYKRDPGTLA
RPWAIPGTPGLEHRIGGIEKQDGTGNISYDPANHDFMVRTRQAKIDGIDVPDIEVDDPDG
ASALVLGWGSTYGPITAAVRRLRTAGESIAQAHLRHLNPFPSNLGAVLKGYDKVVIPEMN
LGQLATLIRAKYLVDAHSYNQVNGMPFKAEQLATALKEAIDD
NT seq 1929 nt   +upstreamnt  +downstreamnt
gtgaccagccaggtcagcagtacaacggaacaggccgacgaacccgtcgtgggagagcag
cgcaaaccggcgggcgcgaaggacgtacgccgactcgatcgcgtgatcatccggttcgcc
ggggactccggtgacggtatgcaactcaccggtgaccgcttcacctcagagacggcgtcc
ttcggaaacgacctctcgaccctgccgaacttccccgccgagatccgggcccccgcgggc
acgctgcccggggtctcctccttccagttgcacttcgcggaccacgacatcctgaccccc
ggcgacgcgccgaacgtcctcgtggcgatgaacccggccgccctcaaggcgaacgtgagc
gacctgccgcgcggcgcggaggtcatcgtcaacacggacgagttcaccaagcgcgccatg
cagaaggtcgggtacggcacgagtccgctggaggacggctcgctggacggctacagcgtc
caccccgtccccctgaccaccctcacggtcgaggcgctcaaggagttcgagctctcccgc
aaggaggccgagcgcagcaagaacatgttcgcgctggggctgctgtcgtggatgtaccac
cggccgaccgagggcaccgagaagttcctgaccaccaagttcgccaagaagccggccatc
gcggcggccaatatcgccgcgttccgggccggctggaacttcggcgagacgacggaggac
ttcgcggtctcctacgaggtcgccccggcccagtccgccttcccggccggcacctaccgc
aacatctccgggaacctggccctgtcgtacggcctgatcgcggcctcccgccaggcggat
ctgccgctgtacctgggctcgtacccgatcaccccggcctccgacatcctgcacgagctg
agcaagcacaagaacttcggcgtccgcaccttccaggccgaggacgagatcgcgggcatc
ggcgcggcgctgggggccgccttcggcggttcgctggcggtcaccacgacctccgggccg
ggtgtggccctcaagtcggagacgatcgggctggccgtctccctcgagctgccgctgctg
gtggtcgacatccagcgcggcggcccgtcgaccggcctgccgaccaagaccgagcaggcg
gacctgctccaggcgatgtacggccgcaacggcgaggcaccggtcccggtggtcgcgccg
cgcacgccggccgactgcttcgaggccgccatcgaggcggcgcggatcgcgctgacgtac
cgcacgccggtgttcctgctctccgacggctatctggccaacggcagcgagccctggcgc
atcccggagaccgacgggctccccgatctgcgcgtgcggttcgcccagggaccgaaccac
accctggacgacggcaccgaggtgttctggccctacaaacgtgacccggggaccctggcc
cgcccgtgggcgatcccgggcacgccgggtctggagcaccgcatcggcggcatcgagaag
caggacggcacgggcaacatctcgtacgaccccgccaaccacgacttcatggtgcgtacc
cgccaggcgaagatcgacggcatcgacgtccccgacatcgaggtcgacgacccggacggg
gcgagcgccctcgtactgggctggggttcgacctacgggcccatcaccgcggccgtacga
cggctgcggacggccggggagtccatcgcgcaggcgcatctgcgccacctcaaccccttc
ccgtcgaacctcggcgcggtgctgaaggggtacgacaaggtggtgatccccgagatgaac
ctcggtcagctcgccacactcatccgggcgaagtacctggtggacgcccactcgtacaac
caggtcaacggaatgccgttcaaggctgagcaactcgccacggctctgaaggaggccatc
gatgactga

DBGET integrated database retrieval system