KEGG   Streptomyces avermitilis: SAVERM_4908
Entry
SAVERM_4908       CDS       T00126                                 
Symbol
secE
Name
(GenBank) putative preprotein translocase SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_4908 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_4908 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_4908 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_4908 (secE)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_4908 (secE)
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-ProteinID: BAC72620
NITE: SAV4908
UniProt: Q82DR1
Position
5964712..5964999
AA seq 95 aa
MTDAVGSIDMPDAQDEAPESKKKTRKGGKRAKKGPLKRLALFYRQIVAELRKVVWPSRNQ
LTTYTTVVIVFVVIMIALVTVIDYGLNHAAKYVFG
NT seq 288 nt   +upstreamnt  +downstreamnt
gtgacggacgccgtgggctccatcgacatgcctgatgcccaggatgaggcgccggagtcc
aagaagaagacccgcaagggcggtaagcgtgccaagaagggcccgctcaagcgccttgcc
ctcttctaccgccagattgtcgcggaactccgcaaggtcgtctggccatctcgaaaccag
ctgacgacgtacacgacagtggtgattgtcttcgtcgtcatcatgatcgccctggtgacc
gtgattgactatgggctcaaccacgcagccaagtacgtcttcggctga

DBGET integrated database retrieval system