KEGG   Streptomyces avermitilis: SAVERM_5016
Entry
SAVERM_5016       CDS       T00126                                 
Symbol
gabD1
Name
(GenBank) putative succinate-semialdehyde dehydrogenase, NADP-dependent
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00310  Lysine degradation
sma00350  Tyrosine metabolism
sma00650  Butanoate metabolism
sma00760  Nicotinate and nicotinamide metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Module
sma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_5016 (gabD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_5016 (gabD1)
   00310 Lysine degradation
    SAVERM_5016 (gabD1)
   00350 Tyrosine metabolism
    SAVERM_5016 (gabD1)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SAVERM_5016 (gabD1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SAVERM_5016 (gabD1)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SAVERM_5016 (gabD1)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SAVERM_5016 (gabD1)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: BAC72728
NITE: SAV5016
UniProt: Q82DG6
Position
6072117..6073748
AA seq 543 aa
MTDSQAPEKTGTDDTTGTNPLAPAPAGARTAADVVTPELVAQLTKGVVGSGRTANHTPFT
GEKLADLPESTPEDVATAFERARAAQIAWGATPVRQRAAVLLRFHDLVLARQAEVLDLIQ
LETGKARLHAHEEVQAVAVAARHYGRKAPAYLKPKRHAGAMPTLTRVTELRHPRGVVGQI
APWNYPLELSVGDALPAFVAGNALVMKPDTETCLTALWARDLLIEAGLPAEVFQVVIGEG
PVVGPEVVKHADYVSFTGSTRTGREVAQGAAARLVGVSLELGGKNAMLVLEDADIDKAAA
GAVRACFSSAGQLCISIERLYVHESVADAFAERFAARTRAMRLGTSLAYGADMGSLVGER
QLETVTRHVDEAVAKGAKLLAGGVARPDIGPYFYEPTILDGVEAPMSVCTEETFGPVVSL
YRFKTEDEAVELANSTPYGLNASVWTKDGRRGRAVAARLRTGTVNVNDGYAPAYGSVQSP
MGGMKDSGLGRRHGSEGILKYTEAQTVAHQRLLPMAPSLGMDDEKYAEFMSRSLKAMKAL
RLR
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgacggactcgcaggccccggaaaagaccggcaccgacgacacgaccggcaccaatccc
ctcgctcccgcccccgcgggcgcccgtaccgccgccgacgtggtcacgccggagctggtc
gcccagctcaccaagggagtggtcggctccggccgtaccgccaaccacacgccgttcacc
ggcgaaaagctggccgacctgcccgagtccacccccgaggacgtcgcgaccgccttcgag
cgggcccgtgccgcgcagatcgcctggggcgcgacgcccgtacggcagcgcgccgccgtc
ctcctgcgcttccacgacctggtgctggcccggcaggccgaggtcctcgacctcatccag
ctggagacgggcaaggcccggctgcacgcccacgaagaggtgcaggccgtcgcggtcgcc
gcccggcactacggccgcaaggcgcccgcgtacctgaagcccaagcggcacgccggtgcc
atgccgacgctcacgcgcgtcaccgaactccgccacccgcggggggtcgtgggccagatc
gccccttggaactacccgctggagctgtcggtcggcgacgcgctgcccgccttcgtcgcg
ggcaacgccctcgtcatgaagcccgacaccgagacctgcctcaccgccctgtgggcgcgc
gacctgctcatcgaggccgggctgcccgccgaggtcttccaggtcgtcatcggcgaaggc
ccggtcgtggggcccgaggtggtcaagcacgccgactacgtctccttcaccggctccacc
cgcaccggccgcgaggtcgcccagggcgcggccgcccggctcgtcggcgtctccctcgaa
ctcggcggcaagaacgccatgctggtcctggaggacgccgacatcgacaaggcggccgcc
ggcgccgtccgcgcctgcttctcctccgccgggcaactgtgcatctccatcgagcggctg
tacgtccacgagtccgtcgccgacgcgttcgcggagcgcttcgccgcccggaccagggcg
atgcggctcggcacgtccctcgcgtacggcgccgacatgggctcgctggtcggcgagcgc
cagctggagaccgtgacccggcatgtcgacgaggccgtcgcgaagggcgcgaagctcctc
gcgggcggcgtcgcgcgcccggacatcggcccctacttctacgagcccaccatcctcgac
ggtgtcgaggccccgatgtccgtgtgcaccgaggagaccttcggcccggtcgtctccctc
taccgcttcaagaccgaggacgaggcggtcgaactcgccaactccacgccgtacggcctc
aacgcgtccgtctggacgaaggacggccggcgcggacgcgcggtcgcggcccgcctgcgc
accggcacggtcaacgtcaacgacggctacgcgcccgcgtacggcagcgtccagtcgccg
atgggcggcatgaaggactccggcctcggccgccgccacggctccgaaggcatcctcaag
tacaccgaggcgcagaccgtcgcccaccagcggctgctgccgatggcgccgtcgctcggc
atggacgacgagaagtacgcggagttcatgagccgcagcctcaaggcgatgaaggcgctc
cggctgcgctag

KEGG   Streptomyces avermitilis: SAVERM_7134
Entry
SAVERM_7134       CDS       T00126                                 
Symbol
gabD2
Name
(GenBank) putative succinate-semialdehyde dehydrogenase, NADP-dependent
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00310  Lysine degradation
sma00350  Tyrosine metabolism
sma00650  Butanoate metabolism
sma00760  Nicotinate and nicotinamide metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Module
sma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_7134 (gabD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_7134 (gabD2)
   00310 Lysine degradation
    SAVERM_7134 (gabD2)
   00350 Tyrosine metabolism
    SAVERM_7134 (gabD2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SAVERM_7134 (gabD2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SAVERM_7134 (gabD2)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SAVERM_7134 (gabD2)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SAVERM_7134 (gabD2)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: BAC74845
NITE: SAV7134
UniProt: Q826P8
Position
complement(8493640..8495034)
AA seq 464 aa
MPIATVNPATGETLKTYEALDAEAIERRLAAAQSAFRTHRTTTFAERARLLHRAADLLDE
DQRDIARVMTTEMGKPVKQARAEAAKCAKAMHWYADHAEELLADEEPADSDVKDSGASRA
LVRYRPLGPVLAVMPWNFPLWQVVRFAAPALMAGNVGLLKHSSNVPQTALYLEDLFRRAG
FPDGCFQTLLIGSGAVEGILRDPRVRAATLTGSEPAGRAVASVAGDQVKKTVLELGGSDP
FVVMPSADIDRAAKTAVTARVQNNGQSCIAAKRFIVHTDVFDAFAERFTAGMAALKVGDP
LDEDTEVGPLSTEQGRTDLEELVDDAVENGATVLCGGERPEGYTERGYYYAPTVLTDITP
EMRIHLEEAFGPVATLYRAADLDEAVAIANDTPFGLSSNVWTREDAEVDRFVRDLEAGGV
FVNGMTASHPAFPFGGVKRSGYGRELSGHGIREFCNITTVWHGA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcccatcgcgacggtgaacccggcgaccggcgagacgctcaagacgtacgaagccctg
gacgccgaggcgatcgagcgcaggctcgcggcggcacagagcgcgttccggacccatcgc
acgaccacgttcgccgagcgggcgcggctgctgcacagggcggcggacctgctcgacgag
gaccagcgggacatcgcccgggtgatgacgaccgagatgggcaagccggtcaagcaggcc
cgcgccgaggccgcgaagtgcgcgaaggcgatgcactggtatgccgaccacgccgaggag
ctgctcgcggacgaggaaccggccgattccgatgtgaaggactccggggcctcgcgcgcc
ctggtccgctatcggccgctgggcccggtgctggccgtgatgccgtggaacttccccctg
tggcaggtggtccggttcgccgcgcccgcgctgatggcgggcaacgtgggcctgctcaag
cactcctcgaacgtcccgcagaccgccctctacctggaggacctgttccgccgggccggc
ttccccgacggctgcttccagacgctgctcatcggctccggcgccgtcgagggcatcctg
cgcgacccgcgcgtccgggcggccacgctgaccggcagcgaaccggccggccgggccgtg
gcctcggtcgccggggaccaggtcaagaagacggtcctggagctcggcggcagcgacccg
ttcgtcgtgatgccgtccgccgacatcgaccgggccgcgaagaccgcggtgaccgcgcgg
gtccagaacaacgggcagtcgtgcatcgccgcgaagcggttcatcgtgcacacggacgtg
ttcgacgccttcgccgagcgcttcacggcgggcatggcggcgctgaaggtcggcgacccg
ctggacgaggacacggaggtcgggccgctctccaccgagcagggccgcaccgatctggag
gagctggtcgacgacgcggtcgagaacggcgcgacggtgctgtgcggcggcgagcgcccc
gaggggtacacggagcgcggctactactacgcgccgaccgtcctcaccgacatcaccccc
gagatgcgcatccacctcgaggaggcgttcggcccggtcgccacgctctaccgggcggcc
gatctcgacgaggcggtggccatcgccaacgacacgccgttcggactgagttccaacgtc
tggacgcgcgaggacgccgaggtcgaccggttcgtacgcgacctggaggccggtggcgtg
ttcgtcaacgggatgacggcatcccatcccgcgttccccttcggcggggtcaagcggtcg
ggttacggtcgtgagctgtccggacacggaatccgcgagttctgcaacatcaccaccgta
tggcacggagcgtga

KEGG   Streptomyces avermitilis: SAVERM_7159
Entry
SAVERM_7159       CDS       T00126                                 
Symbol
gabD3
Name
(GenBank) putative succinate-semialdehyde dehydrogenase, NADP-dependent
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00310  Lysine degradation
sma00350  Tyrosine metabolism
sma00650  Butanoate metabolism
sma00760  Nicotinate and nicotinamide metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Module
sma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_7159 (gabD3)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_7159 (gabD3)
   00310 Lysine degradation
    SAVERM_7159 (gabD3)
   00350 Tyrosine metabolism
    SAVERM_7159 (gabD3)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SAVERM_7159 (gabD3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SAVERM_7159 (gabD3)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SAVERM_7159 (gabD3)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SAVERM_7159 (gabD3)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAC74870
NITE: SAV7159
UniProt: Q826M3
Position
complement(8519323..8520771)
AA seq 482 aa
MSILNDVPKQLFIGGTWADAADGATMPVDDPATGEILCHVADAGPKDARLAADAAVEAQD
GWARTAPRERSEILRRAYEIIVSRTGELALLMTSEMGKPLAEARGEVAYAAEFFRWFSEE
AVRIDGGYGVLPDGRNRMLLMRRPVGPCLLVTPWNFPLAMGTRKIGPAIAAGCTMVLKPA
PQTPLSSLALAGILKEAGLPDGVLNVVTTSRAGEVVEPLLTGGRIRKLSFTGSTRVGRLL
LAQCADAVVRTSMELGGNAPFIVLDDADLSAAVDGAMTAKMRNMGEACTAANRFFVHRSV
ADEFGRRLAERMGALVVGPGTRDGVDVGPLIDEAGRAKVEELVADAVERGARVLVGGVAP
DGPGRFYPPTVLADVDPGSRLMETEIFGPVAAILVFDDEDEVVRRANDTPWGLVGYVFTQ
GLDRALRVSERLEVGMVGVNTGLVSNPAAPFGGVKQSGLGREGGRVGIEEFLEYKYLAVP
LR
NT seq 1449 nt   +upstreamnt  +downstreamnt
gtgagcatcctcaacgacgtgcccaagcagttgttcatcggcggtacctgggcggacgcg
gccgacggcgccaccatgccggtggacgaccccgcgaccggcgagatcctctgccacgtc
gccgacgccggacccaaggacgcccggctcgcggcggacgccgccgtcgaggcacaggac
ggctgggcccgtacggcgccccgcgaacgcagcgagatcctgcgccgcgcgtacgagatc
atcgtctcccgcaccggcgaactcgccctgctgatgaccagcgagatgggcaagccgctg
gccgaggcccggggtgaagtggcctacgcggccgagttcttccgctggttctcggaggag
gcggtacggatcgacggcggctacggcgtcctgccggacggccgcaaccgcatgctgctg
atgcgccgtcccgtcgggccgtgtctgctggtcacgccgtggaacttcccgttggcgatg
ggcacccgcaagatcggcccggcgatcgcggcgggctgcacgatggtgctcaagccggcc
ccgcagactccgctgtccagcctcgcgctggccgggatcctgaaggaggcgggcctgccg
gacggcgtactcaacgtcgtcaccacctcccgggccggggaggtcgtggaaccgttgctg
accggcggacgcatccgcaagctgtccttcaccgggtccacccgggtcgggcggctgctg
ctcgcgcagtgcgccgacgcggtcgtacgcacgtcgatggaactgggcggcaacgccccg
ttcatcgtcctcgacgacgcggacctgagcgcggctgtcgacggggcgatgaccgccaag
atgcgcaacatgggcgaggcctgcaccgccgccaatcgcttcttcgtccaccgctcggtg
gcggacgagttcgggaggcggctcgcggagcggatgggggcgctggtcgtcggtcccggc
acccgggacggcgtggacgtggggccgctgatcgacgaggccggtcgagccaaggtcgag
gagctggtcgccgacgcggtggagcggggcgcccgggtactggtcggcggcgtggcgccg
gacggccccggccgcttctacccgccgaccgtcctggcggacgtcgaccccggcagccgg
ctgatggagacggagatcttcgggccggtggcggcgattctcgtcttcgacgacgaggac
gaggtcgtgcgccgggccaacgacaccccatggggcctggtcggctacgtcttcacgcaa
ggcctggaccgcgccctgcgggtcagcgagcgcctggaggtgggcatggtcggtgtgaac
acggggctggtgtccaaccccgccgcgccgttcggcggcgtcaagcagtccgggctcggc
cgggagggcggccgggtcggcatcgaggagttcctggagtacaagtacctcgcggtgccg
ctccggtga

DBGET integrated database retrieval system