KEGG   Streptomyces avermitilis: SAVERM_5017
Entry
SAVERM_5017       CDS       T00126                                 

Symbol
choD
Name
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00984  Steroid degradation
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SAVERM_5017 (choD)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SAVERM_5017 (choD)
SSDB
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 HI0933_like Fer4_10 Pyr_redox Lycopene_cycl Fer4 Fer4_6
Other DBs
NCBI-ProteinID: BAC72729
NITE: SAV5017
UniProt: Q82DG5
Position
6073813..6075618
AA seq 601 aa
MPQENSAQPPVGYPYDYDVIVVGSGFGGSVTALRLTEKGYRVGVLEAGRRFTRESLPKNS
WDIKNYLWAPRLGMYGIQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKAFFDDPQWKD
ITDWQEELKPYYDQARRMLGVRLNPTMTPSDVHLKAAAGRMGVGDTFHMAPVGVFFGDGQ
DADGTAKAKPGGEVEDPYFGGAGPARKACTECGECMTGCRHGAKNTLNENYLHLAERAGA
VVHPMTTVVAVTDDSQGGYAVQTLPTDEKRKGRGRTFKARRVVVAAGTYGTQTLLHRMKE
GRQLPYLSGRLGELTRTNSEALVGAQTDSRRYRKAHGEPTVDFTRGVAITSSIHPDANTH
IEPVRYGRGSNAMGGLSILQVPYAEGSSRLLAWLANAAKHPLLVARSLSNRRWSERTIIG
LVMQSLDNSLTTYLKPKGAGKGLLTARQGHGAPNPKQIRAASQAATVIAEEINGFPGSNV
GELMGTPLTAHFLGGCPIGDSPASGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTIT
AQAERAMSYWPNKGEADPRPAQGAAYERLKPVEPRHPAVPADAFGALRLPFLGMPTVPPK
E
NT seq 1806 nt   +upstreamnt  +downstreamnt
gtgccacaggagaactctgcccaaccgccggtgggctacccgtacgactacgacgtcatc
gtcgtcggttccggcttcggcgggtcggtcacggccctcaggctcaccgagaagggctac
cgcgtaggcgtgctggaggcgggccgccgcttcacgcgcgagtcgctgcccaagaactcc
tgggacatcaagaactatctgtgggcgcccaggctcggcatgtacggcatccagcgcatc
cacctcctgggcaacgtcatggtgctggcgggcgccggggtcggcggcggctccctcaac
tacgcgaacaccctctacgtaccgccgaaggccttcttcgacgacccgcagtggaaggac
atcaccgactggcaggaggaactgaagccgtactacgaccaggcgcggcgcatgctgggc
gtgcggctcaacccgaccatgacgccgtcggacgtccacctcaaggcggccgccgggcgg
atgggcgtcggtgacaccttccacatggcgccggtcggtgtcttcttcggcgacgggcag
gacgcggacgggacggcgaaggccaagccgggcggcgaagtggaagacccctacttcggc
ggcgcggggcccgcccgcaaggcgtgcaccgagtgcggggagtgcatgacgggctgtcgc
cacggggcgaagaacaccctcaacgagaactatctccacctcgccgagcgggccggcgcc
gtcgtgcacccgatgacgaccgtcgtcgcggtcaccgacgactcgcagggcgggtacgcg
gtccagaccctgcccaccgacgagaagcgcaagggccggggcaggaccttcaaggcgcgg
cgggtggtcgtcgccgccggtacgtacggcacgcagaccctgctgcaccggatgaaggag
ggccgtcaactgccctacctgtccggcaggctgggcgagctgacccgtaccaactccgag
gcgctggtcggcgcgcagaccgactcccgccgctaccgcaaggcgcacggcgagcccacg
gtcgacttcacgcgcggggtcgccatcacgtcctccatccaccccgacgcgaacacccac
atcgagccggtccgctacggccggggctcgaacgcgatgggcggcctgtccatcctccag
gtcccctacgcggagggctcctcgcggctgctcgcctggctggccaacgcggcgaaacac
ccgctgctggtggcccgctcgctctccaaccgccgctggtccgagcggaccatcatcggc
ctggtgatgcagtcgctggacaactccctgacgacgtatctgaaaccgaagggcgcgggc
aagggcctgctgacggcacgccaggggcacggcgcgcccaaccccaagcagatcagggcg
gcttcgcaggccgcgaccgtgatcgccgaggagatcaacggattcccgggcagcaacgtg
ggcgagctgatgggaacaccgctgaccgcgcacttcctgggtggctgcccgatcggcgac
tcgccggcgtcgggggtcatcgacccgtaccaccggctgtacggccaccccggtatctcg
gtcgtcgacggcgccgcggtctccgcgaacctcggcgtgaacccgtcgctcaccatcacg
gcccaggccgagcgggcgatgtcgtactggcccaacaagggcgaggcggacccgcgtccg
gcgcagggagcggcgtacgaacgcctgaagccggtggagccgcggcacccggcggtcccg
gcggacgcgttcggcgcgctcaggctgccgttcctggggatgccgacggtgccgccgaag
gagtag

DBGET integrated database retrieval system