KEGG   Streptomyces avermitilis: SAVERM_5276
Entry
SAVERM_5276       CDS       T00126                                 
Symbol
hmgL
Name
(GenBank) putative hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_5276 (hmgL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5276 (hmgL)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SAVERM_5276 (hmgL)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SAVERM_5276 (hmgL)
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-ProteinID: BAC72988
NITE: SAV5276
UniProt: Q82CR7
Position
complement(6391651..6392598)
AA seq 315 aa
MSTPESGLPMVVPAQDLPARVRIHEVGARDGLQNEKGTVPTEVKAEFIRRLADAGLTTIE
ATSFVHPKWVPQLADAEQLFPLVSDLPVALPVLVPNERGLDRALVLGARQVAVFASATES
FAKANLNRTVDEALAMFEPVVTRAKAADVRVRGYLSMCFGDPWEGAVPIHQVVRVCKSLL
DMGCDELSLGDTIGVATPGHVQDLLAELTEEGVPTRAIGVHFHDTYGQALANTLAALQHG
VTTVDASAGGLGGCPYARSATGNLATEDLVWMLQGLGIDTGVDLARLTATSVWMAERLGR
PSPSRTVRALSHKEQ
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagcacccccgagtcgggcctccccatggtcgtaccggcccaggacctccccgcccgc
gtccgcatccacgaggtcggcgcgcgcgacggcctccagaacgagaaggggacggtcccg
acggaggtcaaggcggagttcatccgccgcctcgccgacgcggggctgaccaccatcgag
gccaccagcttcgtccacccgaagtgggtgccccaactcgccgacgcggagcagctgttc
ccgctcgtgagcgacctccccgtggcgctcccggtcctggtgccgaacgaacgcgggctg
gaccgcgcactggtcctgggcgcccgtcaggtcgccgtcttcgccagcgccaccgagtcc
ttcgcgaaggccaacctcaaccgcacggtggacgaggcgctggccatgttcgagccggtg
gtcacccgtgcgaaggccgcggacgtgcgggtgcgcggttacctctccatgtgcttcggc
gacccctgggagggcgcggtcccgatccaccaggtcgtgcgggtctgcaagtccctcctg
gacatgggctgcgacgagctgagcctcggcgacacgatcggggtcgccacccccggccat
gtccaggacctcctcgccgaactgaccgaggagggcgtgccgacccgtgcgatcggcgtg
cacttccacgacacctacggccaggcgctcgccaacaccctcgccgcgctccagcacggc
gtcacgaccgtcgacgcctccgcgggcggcctcggcggctgcccgtacgccaggtccgcg
accggaaacctcgccaccgaagacctcgtgtggatgcttcagggcctcggtatcgacacc
ggagtcgacctcgcccgtctcaccgccacgagcgtgtggatggccgagcgactgggccgg
cccagcccctcccgcaccgtccgcgccctctcccacaaggagcaatga

DBGET integrated database retrieval system