KEGG   Streptomyces avermitilis: SAVERM_5329
Entry
SAVERM_5329       CDS       T00126                                 
Symbol
recD
Name
(GenBank) putative exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_5329 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_5329 (recD)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SAVERM_5329 (recD)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAVERM_5329 (recD)
SSDB
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 SH3_13 Viral_helicase1 HHH_5 AAA_11 Helicase_RecD AAA_22 PIF1 AAA_16 UvrD_C HTH_IclR PhoH TrwB_AAD_bind HHH_2 AAA DEAD DUF87
Other DBs
NCBI-ProteinID: BAC73041
NITE: SAV5329
UniProt: Q82CL6
Position
6456160..6458436
AA seq 758 aa
MASGASRAAQPGTGERHLAVLEGVLERITYANEENGYTVARVDTGRGAGDLLTVVGSLLG
AQVGESLRMEGRWGSHPQYGKQFTVENYTTVLPATVQGIRRYLGSGLVKGIGPVFADRIT
QHFGLDTLQIIEEEPKRLIEVPGLGPKRTKKITEAWEEQKAIKEVMLFLQTVEVSTSIAV
RIYKKYGDASISVVKNQPYRLATDVWGIGFLTADKIAQSVGIPHDSPERVKAGLQYALSQ
STDQGHCYLPEEQLIADAVKLLQVDTGLVIECLAELAAPSEEDGEPGVVRERLPGPDGGD
PVTAIYLVPFHRAELSLSAQLLRLLRTDQDRMPGFHDVAWDKALDWLKGRTGAELAPEQE
EAVRLALTQKVAVLTGGPGCGKSFTVRSIIELARAKRAKVVLAAPTGRAAKRLAELTGAE
ASTVHRLLELKPGGDAAYDKDRPLDADLVVVDEASMLDLLLANKLVKAVPPGAHLLFVGD
VDQLPSVGAGEVLRDLLADGGPIPAVRLTRVFRQAQQSGVVTNAHRINSGRHPLTDGMKD
FFLFVEDDTEEAGRLTVDVAARRIPAKFGLDPRRDVQVLAPMHRGPAGAGTLNGLLQQAV
TPARPDLPEKRFGGRVFRVGDKVTQIRNNYEKGENGVFNGTVGVVTSLDLDEQRLTVLTD
EDEEVAYEFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKK
LVVLVGSRKAIGQAVRTVSAGRRCTALDFRLSPRPLAP
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggccagtggggcgagtcgggcggcacagccaggtaccggagagcggcacctggccgtg
ctcgaaggcgtactggagcggatcacgtacgccaacgaggagaacggatacacggtcgcg
cgcgtggacaccggccgtggcgccggcgatctgctgaccgtcgtcggctcgctgctcggc
gcccaggtgggggagtcgctgaggatggagggccgttggggttcccatccccagtacggc
aagcagttcaccgtcgagaactacacgaccgtgctcccggccaccgtccagggcatccgc
cgctatctcggctccggcctcgtcaagggcatcggccccgtcttcgccgaccgcatcacc
cagcacttcggcctcgacaccctccagatcatcgaggaggagcccaagcggctgatcgag
gttcccgggctcggacccaagcggacgaagaagatcaccgaggcctgggaggagcagaag
gcgatcaaggaggtcatgctcttcctccagaccgtcgaggtgtcgacgtccatcgcggtc
cgcatctacaagaagtacggcgacgcctccatctccgtcgtcaagaaccagccctaccgc
ctcgccaccgacgtctggggcatcggcttcctcaccgccgacaagatcgcccagtccgtc
ggcatcccgcacgacagcccggagcgcgtcaaggccggtctccagtacgccctttcgcag
tccaccgaccagggccactgctacctccccgaggagcagctgatcgccgacgcggtgaag
ctgctccaggtggacacggggctggtcatcgagtgcctcgcggagctggcggcgccgagc
gaggaggacggcgagcccggcgtcgtacgggagcggctgcccggccccgacggaggggac
ccggtgacggccatctacctcgtccccttccaccgcgccgaactctccctctccgcccag
ctgttgcgcctcctgcgcaccgaccaggaccggatgcccggcttccacgacgtcgcctgg
gacaaggcgctcgactggctcaaggggcgtacgggggcggagctggcccccgagcaggag
gaggccgtccggctcgcgctcacccagaaggtcgcggtcctgaccggaggccccggctgc
ggcaagtcgttcacggtccgttcgatcatcgagctggcccgcgccaagcgggccaaggtc
gtgctcgccgcccccaccggccgcgccgccaaacgcctcgccgagctgaccggcgccgag
gcctccaccgtgcaccggctcctggagctgaagcccggcggcgacgcggcgtacgacaag
gaccgcccgctggacgccgacctggtggtcgtggacgaggcctccatgctcgacctcctc
ctcgccaacaagctggtcaaggcggtcccgccgggcgcccacctcctcttcgtcggcgat
gtcgaccagctgcccagcgtcggcgcgggcgaagtgctccgggacctcctcgcggacggc
ggccccatccccgccgtccgcctcacccgcgtcttccgccaggcccagcagtccggagtc
gtcaccaacgcgcaccgcatcaactccggccggcacccgctcaccgacgggatgaaggac
ttcttcctcttcgtcgaggacgacaccgaggaggccggccggctcacggtggacgtcgcg
gcccgtcgcattcccgccaagttcggcctcgatccgcggcgggacgtccaggtgctcgcc
cccatgcaccggggccccgccggcgcgggcacgctcaacggcctgctccagcaggcggtc
acccccgcccgcccggacctgcccgagaagcggttcggcggccgcgtcttccgcgtcggc
gacaaggtcacccagatccgcaacaattacgagaagggcgaaaacggtgtcttcaacggc
accgtgggcgttgtcacctccctcgacctggatgaacagcgcctgacggtgctgaccgac
gaggacgaggaggtggcgtacgagttcgacgaactcgacgagctggcgcacgcctacgcg
gtgaccatccaccgctcgcagggcagcgagtacccggccgtggtgatcccggtcaccacc
ggcgcctggatgatgctccagcgcaatctgctctacacagcggtgacccgcgccaagaag
ctggtcgtcctcgtcggttcgcgcaaggcgataggccaggcggtgcgcacggtatcggcc
ggacggcgttgcacggccctggacttcaggctttccccgcggcctctcgccccctga

DBGET integrated database retrieval system