KEGG   Streptomyces avermitilis: SAVERM_575
Entry
SAVERM_575        CDS       T00126                                 
Symbol
cyp2
Name
(GenBank) putative cytochrome P450 / NADPH-ferrihemoprotein reductase
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00380  Tryptophan metabolism
sma00627  Aminobenzoate degradation
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_575 (cyp2)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SAVERM_575 (cyp2)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAVERM_575 (cyp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sma00199]
    SAVERM_575 (cyp2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SAVERM_575 (cyp2)
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SAVERM_575 (cyp2)
Cytochrome P450 [BR:sma00199]
 Cytochrome P450, fungi type
  CYP505 family
   SAVERM_575 (cyp2)
 Cytochrome P450, bacteria type
  CYP102 family
   SAVERM_575 (cyp2)
SSDB
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 UCH SIS_2
Other DBs
NCBI-ProteinID: BAC68285
NITE: SAV0575
UniProt: Q82QD5
Position
complement(726776..729997)
AA seq 1073 aa
MTTQPETDLRPIRSPRGVPLFGHTPQIPSTNPVEYFGKLSKQFPEGLYGMEIAGIEQVFV
WDPDLVAEVCDETRFFKQIDKTPLAHVRDYAGAGLFTAHQHEEEWGMAHRVLLPVFSQRA
MKGYFGQMLEIAQNLVGKWERKEGQPVNITDDYTRLTLDTIALSGFGYRFDSFAKEDLHP
FLNALLQALVESLRRSQELPVMTKMRKADDKKYRENIRLMRDLVENVIKERREGKGTGED
DLLGLMLEATDPETGKGLDDDNVRDQVVTFLIAGHETTSGLLSFATYSLMRNPHILAQAY
AEVDRLLPGDTVPDYDTIMQMDVIPRILEETLRLWAPIPMIGKSPLEDTVIGGCYGLKKG
ARVNILEGPLHTHPKAWERPEEFDINRWLPENRVNHHPHAYKPFGNGVRACIGRQFALTE
ARLALALVLQKFKFADTDDYKMDVKEALTRKPGGFELNVRARQEHERTVFGAADLQTDDT
QAQAAVSGVGVNLTVAYGSSLGSCEDLARTIADRGERSGFGTTLVGLDELGDNLPTEGLL
VVVASSYNGKAPDNAQRFDDLLAAGLPEGSLSNVRFALLGAGNTQWVATYQGFPKRIEAG
LLAAGATRVIERGIADAAGDFDGMATRWMDTLWTTLAEEYAADTSETTGPRFEVQLLTEA
EVRPAIVSEQAYPLTVVANEELVSDATGLWDFSIEPPRPAAKSITIELPDGVTYDTGNHL
AVFAKNEPVLVNRALARLGVDRDQVLRLDQPGGGRTHLPVGTPVTTGLLFTEFVELQDVA
TRSQIQELAEHTQCPWTRPQLQAYTADTAEAEERYQKEILGKRVSVLNLLERFPAVELPL
AVFLEMMGPIRPRFYSISSSPLANPRHVRLTVGLLEGPALSGDGRYRGTCSSYIAGLESG
DVFYGYVRVPSPTFAPPADPATPLLLIGPGTGIAPLRGFLEERAHQHAHGTQVGLSQVFV
GCRHPEHDYFYRQEMQDWEQAGIAQVHTAFSAVTGHPARFVQDAIVGAADTVWQAIQDGA
YVYVCGDGRRMAPAVREALAAIYRKHTGSDDEAAQQWLAQLEADERYQQDVFA
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgaccacacagcccgagaccgacctgcggcccatccggtctccgcggggcgtcccgctc
ttcggccacacgccgcagatccccagcaccaacccggtggagtacttcggcaagctgtcc
aagcagttccccgaggggctctacggcatggagatcgccggcatcgagcaggtcttcgtc
tgggacccggacctggtggccgaggtctgcgacgagacgcggttcttcaagcagatcgac
aagacgccgctggcccatgtccgggactacgcgggagccggcctgttcacggcccaccag
cacgaagaggaatggggcatggcgcaccgagtcctcctcccggtcttcagccagcgggcg
atgaagggctacttcgggcagatgctggagatcgcccagaacctggtgggcaagtgggag
cgtaaggagggccagcccgtcaacatcaccgacgactacacccggctgaccctggacacc
atcgccctgtcgggtttcggttaccggttcgactccttcgccaaggaggatctgcacccc
ttcctcaacgcgctgctgcaggcgctggttgagtcgctgcggcgctcgcaggagctgccg
gtgatgaccaagatgcgcaaggccgatgacaagaagtaccgcgagaacatccggctgatg
cgggacctggtcgagaatgtgatcaaggagcgccgtgaggggaagggcacaggtgaggac
gacctgctgggcctgatgctggaggccacggacccggagaccggcaaggggctggacgac
gacaacgtccgtgaccaggtggtgacgttcctgatcgccggtcacgagaccaccagtggt
ctgctgtcgttcgccacgtactcgctgatgcgcaacccgcacatcctggcccaggcctac
gccgaggtggaccgactgctgccgggtgacacggtcccggactacgacacgatcatgcag
atggacgtgatcccgcggatcctggaggagaccctgcgcctgtgggctcccatcccgatg
atcggcaagtccccgctggaggacaccgtcatcggtggctgctacgggctgaagaaggga
gcgcgggtcaacatcctcgagggtccgctgcacacccaccccaaggcgtgggagcggccg
gaggagttcgacatcaaccggtggctgccggagaaccgggtcaaccaccacccgcacgcc
tacaagccgttcggcaacggtgtgcgtgcctgcatcggccggcagttcgcactcaccgag
gcgcgtctggccctcgcgctggttctgcagaagttcaagttcgccgacaccgacgactac
aagatggacgtcaaggaggcgctgacgcgcaagcccggcggcttcgaactgaacgtgcgg
gctcgtcaggagcacgagcggaccgtgttcggcgccgcggacctgcagaccgacgacacg
caggcgcaggccgcggtcagcggtgtcggggtgaacctgaccgtcgcctacggctccagc
ctgggctcgtgcgaggacctggcgcgcaccatcgccgaccgcggtgagcgctccggattc
ggcaccaccctggtcggcctggacgagttgggtgacaacctgcccaccgagggcctgctc
gtcgtcgtggcctccagctacaacggcaaggccccggacaacgcgcagcgcttcgacgac
ctgctcgccgccggactcccggagggctcgctgtccaacgtgcggttcgcgctgctgggt
gccggcaacacgcagtgggtggccacctaccagggcttccccaagcggatcgaggcaggc
ctgctggccgccggcgccacccgcgtcatcgagcgcggtatcgcggacgccgccggtgac
ttcgacggcatggccacccgctggatggacaccctgtggaccaccctggccgaggagtac
gccgccgacacctccgaaaccaccgggccgcgcttcgaggtgcagctgctgaccgaggcg
gaggtgcgtcccgcgatcgtctcggagcaggcctaccccctcaccgtggtcgccaacgag
gagctggtcagcgacgcgaccgggctgtgggacttcagcatcgagccgccgcgcccggcc
gcgaagtccatcaccatcgaactccccgacggtgtcacctatgacaccggcaaccacctg
gccgtcttcgccaagaacgagcccgtgctggtcaaccgcgccctcgcgcggctcggcgtc
gaccgcgaccaggtgctccggctcgaccagcccggcggtggccggacccacctcccggtg
ggcacccccgtcaccacaggcctgctgttcaccgagttcgtcgagctgcaggacgtggcc
acccgatctcagatacaggagctggccgagcacacccagtgcccgtggacccggccgcag
ctgcaggcctacacggccgacaccgccgaagccgaggagcgctaccagaaggagatcctg
ggcaagcgggtctccgtactcaacctgctggagcgcttcccggcggtcgaactgccgctg
gcggtcttcctggagatgatgggcccgatccgcccgcggttctactccatctcctcctcc
ccgctggccaacccgcgccacgtccggctgaccgtcggtctgctggaaggcccggccctg
tccggcgacggccggtaccgcggcacctgctcctcctacatcgcaggcctcgagtccggt
gacgtcttctacggctacgtgcgcgtgccctccccgacgttcgccccgccggccgacccc
gccacgccgctgctcctcatcggccccggcaccggcatcgcgccgctgcgcggcttcctg
gaggagcgtgcccaccagcacgcgcacggcacccaggtgggcctgtcccaggtcttcgtc
ggctgccgccacccggagcacgactacttctaccggcaggagatgcaggactgggagcag
gccgggatcgcccaggtgcacaccgccttctccgcggtgaccggacacccggcccggttc
gtccaggacgccattgtgggtgccgccgacaccgtgtggcaggccatccaggacggcgcg
tacgtctacgtctgcggtgacggccgccgcatggcacccgccgtgcgcgaggcgctcgcc
gccatctaccgaaagcacaccggcagcgacgacgaggccgcccagcagtggctcgcccag
ctggaagcggacgagcgctaccagcaggacgtcttcgcctga

DBGET integrated database retrieval system