KEGG   Streptomyces avermitilis: SAVERM_5800
Entry
SAVERM_5800       CDS       T00126                                 
Symbol
aceE1
Name
(GenBank) putative pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5800 (aceE1)
   00020 Citrate cycle (TCA cycle)
    SAVERM_5800 (aceE1)
   00620 Pyruvate metabolism
    SAVERM_5800 (aceE1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_5800 (aceE1)
SSDB
Motif
Pfam: PDH_E1_M Transketolase_N RL Transketolase_C
Other DBs
NCBI-ProteinID: BAC73512
NITE: SAV5800
UniProt: Q82BA5
Position
complement(7004704..7007451)
AA seq 915 aa
MASGSDRNPIIIGGLPSQVPDFDPEETQEWLDSLDAAVDERGRERARYLMLRLIERAREK
RVAVPEMRSTDYVNTIATKDEPFFPGNEEIERRILNATRWNAAVMVSRAQRPGIGVGGHI
ATFASSASLYDVGFNHFFRGKDEGDGGDQIFFQGHASPGIYARAFLLDRLDERQLDAFRQ
EKSKAPYGLSSYPHPRLMPDFWEFPTVSMGLGPLGAIFQARMNRYMEARGIADTSKSHVW
AFLGDGEMDEPESLGQLSIAAREGLDNLTFVVNCNLQRLDGPVRGNGKIIQELESQFRGA
GWNVIKLVWDRTWDPLLAQDRDGVLVNRLNTTPDGQFQTYATETGDYIRRHFFGDDHRLR
AMVEHMTDDQILHLGRGGHDHKKIFAAFSAAKAHKGQPTVILAQTVKGWTLGPNFEGRNA
THQMKKLTVADLKGFRDRLHLPISDKQLESGPPPYYHPGRDSEELQYMHDRRKGLGGYVP
TRVVRSQPLALPDDKTYAGVKKGSGQQSIATTMAFVRLLKDLMRDKEIGKRFVLIAPDEY
RTFGMDSFFPSAKIYNPLGQQYEAVDRDLLLAYKESPTGQMLHDGISEAGCTASLIAAGS
AYATHGEPLIPVYVFYSMFGFQRTGDQFWQMADQMARGFVLGATAGRTTLTGEGLQHADG
HSQLLASTNPGCVAYDPAFGFEIAHIVQDGLRRMYGSSEEYPHGEDVFYYLTVYNEPIQH
PAEPENVDVEGILKGIHRFSEGTAGSIPAQIIASGVAVPWAVEAQRILAEEWNVKADVWS
ATSWNELRREAVEVERHNLLHPEEEQRVPYVTQKLSAAEGPFVAVSDWMRSVPDQISRWV
PGTYQSLGADGFGFADTRGAARRFFHIDAQSIVVGVLTELAREGKVDRSVLKQAIDRYQL
LDVAAADPGAAGGDA
NT seq 2748 nt   +upstreamnt  +downstreamnt
gtggcttccggatccgatcgcaacccgatcatcattggcggccttccgagtcaggttcct
gacttcgatcccgaagagacccaggagtggctcgactccctcgacgccgccgtcgacgag
cggggccgggagcgggcccgctatctgatgctgcgcctgatcgagcgagcccgcgagaag
cgcgtggccgtgcccgagatgcgcagcacggactacgtcaacaccatcgccaccaaggac
gagccgttcttccccggcaacgaggagatcgagcgcaggatcctgaacgcgacccgctgg
aacgccgcggtcatggtctcgcgcgcccagcggccgggcatcggggtcggcggccacatc
gccaccttcgcctcctccgcctcgctctacgacgtgggcttcaaccacttcttccgcggc
aaggacgagggcgacggcggcgaccagatcttcttccagggccatgcctcgccgggcatc
tacgcccgcgcgttcctcctggaccggctggacgagcggcagctcgacgccttccggcag
gagaagtcgaaggcgccgtacgggctgtcctcgtacccgcacccgcggctgatgccggac
ttctgggagttcccgaccgtctccatgggcctcggcccgctcggcgcgatcttccaggcg
cggatgaaccgctacatggaggcgcgcggcatcgcggacacctccaagtcgcacgtctgg
gcgttcctcggtgacggcgagatggacgagccggagtcgctcggccagctgtcgatcgcg
gcgcgcgagggcctcgacaacctgaccttcgtcgtcaactgcaacctccagcgcctcgac
ggcccggtgcgcggcaacggcaagatcatccaggagctggagtcgcagttccggggcgcc
ggctggaacgtgatcaagctggtctgggaccgcacctgggacccgctgctcgcccaggac
cgcgacggcgtgctggtcaaccggctgaacaccacgccggacggccagttccagacgtac
gccaccgagaccggcgactacatccgtcggcacttcttcggtgacgaccaccggctgcgg
gcgatggtcgagcacatgaccgacgaccagatcctgcacctggggcgcggcggtcacgac
cacaagaagatcttcgcggcgttctcggcggccaaggcgcacaagggccagccgacggtg
atcctggcgcagacggtcaagggctggaccctcggcccgaacttcgagggccgcaacgcc
acgcaccagatgaagaagctgacggtcgccgacctcaagggcttccgcgaccgcctgcac
ctgccgatctccgacaagcagctggagtccggcccgccgccgtactaccacccgggccgc
gactcggaggagctccagtacatgcacgaccgccgcaaggggctcggcgggtacgtcccg
acgcgcgtcgtgcggtcgcagccgctggccctgccggacgacaagacgtacgcgggtgtg
aagaagggctccggtcagcagtcgatcgccacgaccatggcgttcgtacggctgctcaag
gacctcatgcgggacaaggagatcggcaagcggttcgtgctgatcgcgcccgatgagtac
cgcaccttcggcatggactcgttcttcccgagcgcgaagatctacaacccgctcggccag
cagtacgaggccgtggaccgcgacctgctgctcgcgtacaaggagtcgccgaccggccag
atgctgcacgacggcatctcggaggcgggctgtacggcctcgctgatcgccgcgggttcg
gcgtacgcgacgcacggcgaaccgctgatcccggtgtacgtcttctactcgatgttcggt
ttccagcgcaccggcgaccagttctggcagatggccgaccagatggcgcgcggtttcgtg
ctgggcgcgaccgccgggcgcacgaccctgaccggtgagggtctccagcacgcggacggc
cactcccagctgctcgcctcgaccaacccgggctgcgtcgcgtacgaccccgcgttcggc
ttcgagatcgcgcacatcgtgcaggacggcctgcgccggatgtacggctcgtccgaggag
tacccgcacggcgaggacgtcttctactacctcaccgtctacaacgagccgatccagcac
cccgccgagccggagaacgtggacgtcgagggcatcctcaagggcatccaccgcttcagc
gaaggcacggcgggctcgatcccggcgcagatcatcgcgtccggcgtcgccgtcccgtgg
gccgtcgaggcgcagcggatcctcgccgaggagtggaacgtcaaggcggacgtctggtcg
gcgacctcctggaacgagctgcggcgcgaggccgtcgaggtggagcggcacaatctgctg
caccccgaggaggagcagcgcgtcccctacgtgacgcagaagctgagcgccgccgagggt
ccgttcgtggcggtgtccgactggatgcggtcggtgcccgaccagatctcgcggtgggtg
ccggggacgtaccagtccctgggcgcggacggcttcggcttcgcggacacccgtggggcg
gcacggcgcttcttccacatcgacgcgcagtcgatcgtggtcggggtgctgaccgagctg
gcgcgcgagggcaaggtcgaccggtcggtgctgaagcaggcgatcgaccgctaccagctg
ctcgacgtggcggcggccgacccgggcgcggcgggcggcgacgcgtag

KEGG   Streptomyces avermitilis: SAVERM_6020
Entry
SAVERM_6020       CDS       T00126                                 
Symbol
aceE2
Name
(GenBank) putative pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6020 (aceE2)
   00020 Citrate cycle (TCA cycle)
    SAVERM_6020 (aceE2)
   00620 Pyruvate metabolism
    SAVERM_6020 (aceE2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_6020 (aceE2)
SSDB
Motif
Pfam: PDH_E1_M Transketolase_N DUF3135 DUF5576
Other DBs
NCBI-ProteinID: BAC73732
NITE: SAV6020
UniProt: Q82AN6
Position
complement(7246738..7249440)
AA seq 900 aa
MTDPTAIQPSELDQLPDRDPEETAEWQASLDAVTQAAGPHRAAYLMRRTLERAEGNGIAL
PKLLETDYVNTIPTSAEPVVDGDEEMEHRITAWNRWNAAAMVTRGSKYGVGGHIATFASA
AWLYETGFNHFFRGKEADGSGDQLYIQGHASPGIYARAFLDGRLTEHHLDHFRQESGGNG
LPSYPHPRRLPWLWEFPTVSMGLGPLSAIYQARFNRYLTSRGIKDVSQSHVWAFLGDGEM
DEPESTAALALASREGLDNLTFVINCNLQRLDGPVRANFKIVQELEAQFRGAGWNVVKTL
WGSAWDELFQLDTTGALVRRLREVPDAQVQTYQTRDAAYIRQDFFGADPALVEMAKLIGD
DKILECFHLSRGGHESRKVYAAYRAAVSHKGAPTVILAQTVKGHTLGEGFASKNANHQMK
KLSTDEFKQMRDLLELPISDSQFVDGVVPYGHPGADSPEVRYLQERRAALGGPAPARRTH
PLAPLPAPADKTFASFDKGSGSQNVATTMAFVRLVKDLVRDKQTGRRWVPIVPDEARTFG
MESLFPSLGIYSPKGQTYEPVDRDQLMYYKEAKDGQILNEGITEAGSMADFIAASTAYST
HGEAMIPFYIFYSMFGWQRTADQMWQLGDQLGRGFLVGATAGRTTLTGEGLQHADGHSPV
IAATNPAALTYDPAFAYEIAVIVKDGLRRMYGEAAPGEDPNVFYYLTVYNEPVPQPAKPA
GLGIDEGIVKGLYRFNTAESADLSPAANAPRIQLLGSGTAIHWVLQAQRLLAEEWGVAAD
VWSATSWTELRRDALEADAALLRGEERVPFVRQALHGAEGPVLAVSDYMRQVPDQIAQWV
EQDYSSLGADGFGLSDTRDAARRHFGVDAESIVVAALAQLARRGEVKATAVKEARERYGL
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgaccgaccccaccgcaatccagccgagcgagctcgaccagctcccggaccgcgacccc
gaggagaccgccgagtggcaggcctccctggacgccgtcacccaggcggccgggccgcac
cgtgccgcgtacttgatgcgccgcacactggagcgcgccgagggcaacggcatcgcgctg
ccgaagctgctcgagacggactacgtcaacaccatccccacctccgccgagcccgtcgtg
gacggcgacgaggagatggagcaccggatcaccgcgtggaaccgctggaacgcggccgcg
atggtcacccggggcagcaaatacggcgtgggcggccacatcgccaccttcgcctccgcc
gcctggctgtacgagaccggcttcaaccacttcttcaggggcaaggaggcggacggttcc
ggtgaccagctctacatccagggccacgcctccccgggcatctacgcccgcgccttcctc
gacggccggctgaccgagcaccacctcgaccacttccgccaggagtccggcggcaacggt
ctgccgtcgtacccgcacccgcgccgtctcccctggctgtgggagttcccgacggtgtcg
atgggcctcggcccgctctccgcgatctaccaggcgcgcttcaaccgctacctgaccagc
cgcggcatcaaggacgtctcgcagtcccacgtgtgggcgttcctcggcgacggcgagatg
gacgagcccgagtcgaccgcggcactcgccctggcctcccgcgagggcctggacaacctg
accttcgtcatcaactgcaacctccagcgcctcgacggcccggtccgcgccaacttcaag
atcgtgcaggagctggaggcccagttccgcggtgccggctggaacgtcgtcaagacgctg
tggggctcggcctgggacgagctgttccagctcgacaccacgggcgccctcgtacgccgc
ctgcgcgaggtaccggacgcgcaggtgcagacgtaccagacccgcgacgccgcctacatc
cgccaggacttcttcggcgccgacccggccctcgtcgagatggcgaagctgatcggcgac
gacaagatcctcgagtgtttccacctctcccgcggtggtcacgagtcgcgcaaggtctac
gcggcctacagggcggccgtgtcccacaagggcgcgccgacggtgatcctggcccagacg
gtcaagggccacaccctcggcgagggcttcgcgtcgaagaacgccaaccaccagatgaag
aagctgtcgacggacgagttcaagcagatgcgtgacctgctggaactgcccatctccgac
agccagttcgtcgacggcgtggtgccctacggccacccgggcgccgactcccccgaggtc
cgctaccttcaggagcgccgcgcggccctcggcggcccggccccggcccgccgtacgcac
ccgctggccccgctgccggcccccgccgacaagacgttcgcgtccttcgacaagggctcc
ggctcgcagaacgtggcgacgacgatggcgttcgtccggctggtcaaggacctggtccgc
gacaagcagaccggccggcgctgggtgccgatcgtgccggacgaggcccgtaccttcggt
atggagtcgctcttcccgtccctcggcatctattcgccgaagggccagacgtacgagccg
gtcgaccgcgaccagctgatgtactacaaggaggccaaggacggccagatcctcaacgag
gggatcaccgaggccggctccatggcggacttcatcgccgcgtccaccgcgtactccacg
cacggcgaagcgatgatccccttctacatcttctactcgatgttcggctggcagcgcacg
gccgaccagatgtggcagctcggcgaccagctgggccgcggcttcctggtcggcgcgacg
gccggccgtacgacgctgacgggtgagggcctccagcacgcggacggccactcgccggtc
atcgccgcgaccaacccggcggcgctgacgtacgacccggcgttcgcgtacgagatcgcg
gtcatcgtcaaggacggtctgcgccgtatgtacggcgaggcggccccgggcgaggacccg
aacgtcttctactacctcaccgtctacaacgagccggtgccgcagcccgcgaagccggcc
ggcctcggcatcgacgagggcatcgtcaagggcctgtaccgcttcaacacggccgagtcg
gcggacctgtcccccgccgccaacgccccgcgcatccagctgctgggctccggcacggcg
atccactgggtgcttcaggcgcagcggctgctcgccgaggagtggggtgtggccgccgac
gtgtggtccgcgacctcctggaccgagctgcggcgcgacgcgctcgaggccgacgcggcg
ctgctgcgcggcgaggagcgggtgccgttcgtccgccaggcgctgcacggcgccgagggc
ccggtgctcgcggtctccgactacatgcgtcaggtcccggaccagatcgcgcagtgggtc
gagcaggactactcgtcgctcggtgcggacggcttcggcctctccgacacccgtgacgcg
gcccgccgtcacttcggcgtggacgcggagtcgatcgtcgtcgcggccctggcccagctc
gccaggcgcggcgaggtcaaggccacggcggtgaaggaggcgcgggagcgctacggcctg
tag

DBGET integrated database retrieval system