KEGG   Streptomyces avermitilis: SAVERM_5841
Entry
SAVERM_5841       CDS       T00126                                 

Symbol
cyp22
Name
(GenBank) cytochrome P450 hydroxylase
  KO
K15981  cholest-4-en-3-one 26-monooxygenase [EC:1.14.15.29]
Organism
sma  Streptomyces avermitilis
Pathway
sma00984  Steroid degradation
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SAVERM_5841 (cyp22)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sma00199]
    SAVERM_5841 (cyp22)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.29  cholest-4-en-3-one 26-monooxygenase [(25S)-3-oxocholest-4-en-26-oate forming]
     SAVERM_5841 (cyp22)
Cytochrome P450 [BR:sma00199]
 Cytochrome P450, bacteria type
  CYP125 family
   SAVERM_5841 (cyp22)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAC73553
NITE: SAV5841
UniProt: Q82B64
Position
complement(7047868..7049112)
AA seq 414 aa
MPCPALPDGFDLTDPDLLHQRVPLPEFAELRRTAPVHWVPQQHGLAGFQDDGYWAVTRHA
DVKYVSTHPELFSSYLNTAIIRFHETMQREQIDAQRLFMLNMDPPEHTRVRQIVQRGFTP
RAIRALEDTLRRRARSIVETALADAGPDGSFDFVTQVACELPLQAIAELIGIPQDDRAKI
FDWSNKMIAYDDPEYAITEEVGAESATELIAYAMNMAADRKQCPAKDIVSTLVAAEDVGN
LASDEFGFFVLMLAVAGNETTRNAITHGMHAFLTHPDQWDLYKRERPATAAEEIVRWATP
VVSFQRTATQDTELGGKQIRKGDRVGIFYSSANHDPEVFEHPDVFDITRDPNPHLGFGGG
GPHFCLGKSLAVVEIDLIFGAIADVMPGLRLTGDPRRLRSAWLNGVKGLQVSAG
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccctgtccagcgctgcccgacgggttcgacctcaccgaccccgatctgctgcaccag
cgcgtacccctcccggagttcgccgagctgcgccggaccgcgccggtgcactgggtcccg
caacagcacgggctcgccggcttccaggacgacggctactgggccgtcacccggcacgct
gacgtcaagtacgtctccacgcaccccgaactcttctcctcctacctcaacaccgcgatc
atccgcttccacgagacgatgcaacgcgaacagatagacgcccagcggctgttcatgctc
aacatggacccgccggagcacaccagggtccgccagatcgtgcagcgcggcttcactccg
cgcgccatccgcgccctcgaggacaccctgcgcaggcgcgcccgctcgatcgtcgagacc
gcgctcgcggacgccggcccggacggctccttcgacttcgtcacccaggtcgcctgcgaa
ctgcccctccaggccatcgccgaactcatcggcatcccgcaggacgaccgcgcgaagatc
ttcgactggtccaacaagatgatcgcgtacgacgatccggagtacgcgatcaccgaggag
gtcggcgccgagtcggccaccgaactcatcgcctacgccatgaacatggccgccgaccgc
aagcagtgcccggccaaggacatcgtcagcacgctggtcgccgccgaggacgtgggcaac
ctcgcctcggacgagttcggcttcttcgtgctgatgctggccgtcgccggcaacgagacg
acgcgcaacgccatcacgcacggcatgcacgccttcctcacccaccccgaccagtgggac
ctctacaagcgggagcgcccggcgaccgccgccgaggagatcgtccgctgggcgaccccg
gtcgtctccttccagcgcacggcgacccaggacaccgaactgggcggcaaacagatcagg
aagggcgaccgcgtcggcatcttctactcctccgccaaccacgaccccgaggtcttcgag
cacccggacgtcttcgacatcacccgcgaccccaacccgcacctcggcttcggcggcgga
ggcccgcacttctgcctcggcaagtcgctggccgtggtggagatcgacctcatcttcggc
gcgatcgcggacgtcatgcccggtctgcgcctgaccggcgacccgcgcaggctgcgctcg
gcctggctgaacggggtcaaaggcctccaggtgagcgccggttga

DBGET integrated database retrieval system