KEGG   Streptomyces avermitilis: SAVERM_5965
Entry
SAVERM_5965       CDS       T00126                                 
Name
(GenBank) putative hydrolase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
sma  Streptomyces avermitilis
Pathway
sma00361  Chlorocyclohexane and chlorobenzene degradation
sma00364  Fluorobenzoate degradation
sma00623  Toluene degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    SAVERM_5965
   00361 Chlorocyclohexane and chlorobenzene degradation
    SAVERM_5965
   00623 Toluene degradation
    SAVERM_5965
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     SAVERM_5965
SSDB
Motif
Pfam: DLH BAAT_C Abhydrolase_6 Hydrolase_4 Esterase Thioesterase Abhydrolase_1 Peptidase_S9 ABHD18 Chlorophyllase2
Other DBs
NCBI-ProteinID: BAC73677
NITE: SAV5965
UniProt: Q82AU0
Position
complement(7182115..7182849)
AA seq 244 aa
MPTKTLRIPTTDGQADAFAAFPDHSERYPGVLMYADGFGIRPVLREMALELAGHGYYVLV
PNSFYRHGPAPLVELPEYIGEGIRPAVFAQLMPLIEAHTAERVLSDADAYLRFLTTQPEV
GAGPVAVTGYCIGGLYAMRTAAAHPDQVAAVAAFHGPVGVDGANLFSKLTAQVHLGHAEG
DMTPEALGELNQALDAAGVGYTSEIYPGTIHGFTMSDTDAYSAFGLKRHWDRLLPLLDRT
LANS
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcccaccaagacgttgcggattcccaccacggacggccaggccgacgccttcgccgcc
ttccccgaccacagcgagcggtacccaggggtgctgatgtacgcggacggcttcggcatc
cggcccgtgctgcgggagatggccctcgaactggccgggcacggctactacgtgctcgtc
cccaactccttctaccggcacggcccggcaccgctggtcgagcttcccgagtacatcgga
gaagggatccggcccgcggtcttcgcccagctgatgcccctgatcgaggcgcacaccgcc
gaacgtgtcctgagcgacgccgacgcctacctcaggttcctcaccacccaacccgaggtc
ggcgccggaccggtcgcggtgaccggctactgcataggcggcctctacgcgatgcgcacc
gccgcggcccaccccgaccaggtggcggccgtcgccgcgttccacggcccggtgggtgtc
gatggggccaatctcttctccaagctcaccgcccaggtccacctcggccacgccgaaggc
gacatgacgcctgaggccctcggcgagctcaaccaggccctggatgcggcaggtgtcggc
tacacctccgagatctaccccggcaccatccacggcttcaccatgtccgacaccgacgcc
tatagcgccttcgggctgaagcgccactgggatcgcctgctcccccttctggaccgcacc
ctggccaacagctga

DBGET integrated database retrieval system