KEGG   Streptomyces avermitilis: SAVERM_6009
Entry
SAVERM_6009       CDS       T00126                                 
Symbol
lipA
Name
(GenBank) putative lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma00785  Lipoic acid metabolism
sma01100  Metabolic pathways
sma01240  Biosynthesis of cofactors
Module
sma_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    SAVERM_6009 (lipA)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     SAVERM_6009 (lipA)
SSDB
Motif
Pfam: Radical_SAM LIAS_N
Other DBs
NCBI-ProteinID: BAC73721
NITE: SAV6009
UniProt: Q82AP7
Position
complement(7235472..7236458)
AA seq 328 aa
MSAVAPDGRKMLRLEVRNAQTPIERKPEWIKTRAKMGPEYTKMQNLVKSEGLHTVCQEAG
CPNIYECWEDREATFLIGGDQCTRRCDFCQIDTGKPEALDRDEPRRVGESVVTMDLNYAT
ITGVARDDLEDGGAWLYAETVRQIHAQTAGREAGRTKVELLAPDFNAEPDQLAEVFSARP
EVFAHNVETVPRIFKRIRPGFRYERSLKVITEARDYGLVTKSNLILGMGETREEVSEALR
QLHDAGCELITITQYLRPSVRHHPVERWVKPHEFVELKEEAEEIGFSGVMSGPLVRSSYR
AGRLYQMAMELRQSAAPQGGAQVASQAV
NT seq 987 nt   +upstreamnt  +downstreamnt
gtgtccgcagtcgcacccgacggacgcaagatgctgcgcctggaggtccggaacgcccag
acccccatcgagcgcaagcccgagtggatcaagacccgggcgaaaatgggtcccgaatac
acgaagatgcagaacctcgtgaagagcgaggggctgcacacggtctgccaggaggcgggc
tgtcccaacatctacgagtgctgggaagaccgcgaggccaccttcctcatcggcggcgac
cagtgcacccggcgctgcgacttctgccagatcgacaccggcaagcccgaggccctcgac
cgcgacgagccgcgccgcgtcggtgagtccgtcgtcacgatggacctgaactacgccacg
atcacgggcgtcgcccgcgacgacctcgaggacggcggcgcctggctgtacgcggagacg
gtccgccagatccacgcgcagacggcgggccgcgaggccggccgcaccaaggtcgagctg
ctcgcccccgacttcaacgccgagcccgaccagctggccgaggtcttctccgcgcgcccc
gaggtcttcgcgcacaacgtcgagacggtcccgcggatcttcaagcgcatccgccccggc
ttccgctacgagcgctccctgaaggtcatcacggaggcccgggactacggtctggtcacg
aagtcgaacctcatcctcggcatgggtgagacccgcgaagaggtcagcgaggcgctccgg
cagctgcacgacgcgggctgcgagctcatcacgatcacgcagtacctgcgcccctccgtg
cgccaccaccccgtggagcgctgggtcaagccgcacgagttcgtggaactcaaggaggag
gccgaggagatcggcttctccggtgtcatgtcgggcccgctggtccgctcctcgtaccgg
gccggccgcctgtaccagatggccatggagctgcgtcagtcagccgctccgcagggcggt
gcgcaggtcgcctcgcaggcggtctga

DBGET integrated database retrieval system