KEGG   Streptomyces avermitilis: SAVERM_6022
Entry
SAVERM_6022       CDS       T00126                                 
Symbol
sucB
Name
(GenBank) putative dihydrolipoamide S-succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6022 (sucB)
   00020 Citrate cycle (TCA cycle)
    SAVERM_6022 (sucB)
   00620 Pyruvate metabolism
    SAVERM_6022 (sucB)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAVERM_6022 (sucB)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3
Other DBs
NCBI-ProteinID: BAC73734
NITE: SAV6022
UniProt: Q82AN4
Position
complement(7250648..7252471)
AA seq 607 aa
MPVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPSPAAGVLASIK
VAEDETVEVGAELAVIDDGTGAPAAAPAPAAEQAAEQVAPPAPEPAPQATPSTEQAAPAP
APTAEAAAGAGSAEGTDVVLPALGESVTEGTVTRWLKEVGEEVSEDEPLLEVSTDKVDTE
IPAPASGTLLLEIVVGEDETAEVGAKLAVIGAPGAAPAAAPAQAAPAPAAAPAAPAPAPA
APAPAAPAPAPAAPAPAQAAPAAPAAPAQAAPAPAAPQAPAAPAPAPVTPAAAPAATSGD
DGAYVTPLVRKLAAENGVDLATVKGTGVGGRIRKQDVTAAAEAAKAAAPAPAAAPAAAKK
APALEVSPLRGQTVKMPRIRKVIGDNMVKALHEQAQLSSVVEVDITRLMKLRAQAKDSFA
AREGVKLSPMPFFVKAAAQALKAHPAVNARINVDEGTITYFDTENIGIAVDSEKGLMTPV
IKHAGDLNIAGIAKATADLAGKVRANKITPDELSGATFTISNTGSRGALFDTIIVPPNQV
AILGIGATVKRPAVIETEEGTVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGE
FEVELGL
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgccggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgctggctgaaggccgagggtgaacgcgtcgaggccgacgagccgctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccctcccccgccgccggcgtgctcgcgtccatcaag
gtcgccgaggacgagacggtcgaggtcggcgccgagctggccgtcatcgacgacggcacg
ggcgcgcccgccgccgccccggccccggccgccgagcaggccgccgagcaggtcgccccg
ccggctcccgagccggcgccgcaggccaccccgtccaccgagcaggccgcccccgcgccg
gccccgaccgccgaggccgccgccggcgccggcagcgccgagggcaccgacgtcgtcctg
cccgcgctgggcgagtcggtcaccgagggcaccgtcacccgctggctgaaggaggtcggc
gaggaggtctcggaggacgagccgctgctcgaggtctccacggacaaggtcgacaccgag
atcccggcgcccgcctccggcacgctgctgctcgagatcgtggtcggcgaggacgagacg
gccgaggtcggcgcgaagctcgccgtcatcggtgcgcccggtgccgctccggcggccgcc
ccggcgcaggccgcgcccgcgcccgccgccgccccggccgccccggctcccgccccggct
gccccggctccggccgctccggctccggctccggccgccccggccccggctcaggccgcc
cccgcggcgcccgccgccccggctcaggccgctccggccccggccgctccgcaggccccg
gccgccccggcgccggcccccgtcaccccggccgcggcgcccgccgcgacctccggtgac
gacggcgcctacgtgaccccgctggtgcgcaagctcgccgccgagaacggcgtcgacctg
gccaccgtcaagggcaccggcgtcggcggccgcatccgcaagcaggacgtcaccgccgcc
gccgaggccgcgaaggccgccgctccggcgcccgccgccgctccggccgccgcgaagaag
gccccggccctggaggtctcccccctccgcggccagaccgtcaagatgccccgcatccgc
aaggtcatcggcgacaacatggtgaaggccctgcacgagcaggcccagctctcctcggtc
gtcgaggtggacatcacccgcctgatgaagctccgcgcgcaggcgaaggactccttcgcg
gcccgcgagggcgtcaagctctccccgatgccgttcttcgtgaaggcggcggcccaggcg
ctgaaggcccacccggccgtcaacgcccggatcaacgtggacgagggcacgatcacctac
ttcgacaccgagaacatcggtatcgcggtggactccgagaagggcctgatgaccccggtc
atcaagcacgcgggcgacctcaacatcgccggtatcgccaaggccaccgccgacctggcg
ggcaaggtccgggcgaacaagatcaccccggacgagctgtccggcgcgaccttcaccatc
tccaacaccggctcgcgcggcgcgctcttcgacacgatcatcgtgccgccgaaccaggtc
gcgatcctcggcatcggtgccacggtcaagcgcccggccgtcatcgagacggaggagggt
acggtcatcggcgtccgcgacatgacgtacctgacgctctcctacgaccaccgtctggtg
gacggcgccgacgcggcccgttacctgaccgcggtcaaggcgatcctggaggcgggcgag
ttcgaggtcgagctcggcctgtaa

DBGET integrated database retrieval system