KEGG   Streptomyces avermitilis: SAVERM_6100
Entry
SAVERM_6100       CDS       T00126                                 
Symbol
metF
Name
(GenBank) putative 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADH) [EC:1.5.1.54]
Organism
sma  Streptomyces avermitilis
Pathway
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_6100 (metF)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.54  methylenetetrahydrofolate reductase (NADH)
     SAVERM_6100 (metF)
SSDB
Motif
Pfam: MTHFR DUF5848
Other DBs
NCBI-ProteinID: BAC73811
NITE: SAV6100
UniProt: Q82AF8
Position
7336079..7337002
AA seq 307 aa
MALGTASTRTDRARTVRDMLASGKTTYSFEFSAPKTPKGERNLWSALRRVEAVAPDFVSV
TYGAGGSTRAGTVKETEQIVADTTLTPVAHLTAVNHSIAELRNIIGQYADAGIRNMLAVR
GDPPGDPMGEWVPHPRGLTYAAELVRLIKESGDFCVGVAAFPEMHPRSADWEADVERFVD
KCRAGADYAITQMFFHPESYLRLRDRVAAAGCETPVIPEIMPVTSVKMLERLPQLSNAAI
PSVLQERILTAKDDPAAVRSIGIEFATEFCARLLAEGVPGLHFITLNNSTATLEIYENLG
LHHPQQA
NT seq 924 nt   +upstreamnt  +downstreamnt
atggccctcggaaccgcatccaccaggactgatcgcgcacgcactgtgcgtgacatgctc
gcgtccggcaagaccacgtactcgttcgagttctcggcgccgaagacccccaagggcgag
cggaacctgtggagcgcgctcaggagggtcgaggcggtcgcccccgacttcgtctccgtg
acctacggggccggcggttccacccgcgcgggcacggtcaaggagaccgagcagatcgtc
gccgacacgacgctcaccccggtcgcgcacctgaccgcggtcaaccactccatcgcggag
ctgcgcaacatcatcggccagtacgcggacgccgggatccgcaacatgctcgccgtgcgc
ggcgacccgcccggcgacccgatgggcgagtgggtgccgcacccgagggggctgacgtac
gcggccgaactggtgcgtctcatcaaggagtcgggcgacttctgcgtgggagtcgcggcc
ttccccgaaatgcatccgcgctccgccgactgggaagccgacgtcgagcgcttcgtcgac
aagtgccgggccggcgccgactacgcgatcacccagatgttcttccaccccgagtcgtat
ctgcggctgcgtgaccgcgtcgccgcggccggctgcgagaccccggtgatccccgagatc
atgccggtgacgagtgtgaagatgctggaacggctgccacagctcagcaacgccgcgatc
ccgtccgttctgcaagagcggatcctcacagccaaagacgatccggcggctgtacgctcc
attggcatcgagttcgccacggagttctgcgcgaggttgctggccgagggagtccccgga
cttcacttcattacgctgaacaactccaccgcgacgctggagatctacgaaaatctggga
ctgcaccacccacagcaggcctag

DBGET integrated database retrieval system