KEGG   Streptomyces avermitilis: SAVERM_6118
Entry
SAVERM_6118       CDS       T00126                                 
Symbol
murF
Name
(GenBank) putative UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
sma  Streptomyces avermitilis
Pathway
sma00300  Lysine biosynthesis
sma00550  Peptidoglycan biosynthesis
sma01100  Metabolic pathways
sma01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SAVERM_6118 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAVERM_6118 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SAVERM_6118 (murF)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     SAVERM_6118 (murF)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF561 DUF2126
Other DBs
NCBI-ProteinID: BAC73829
NITE: SAV6118
UniProt: Q82AE0
Position
7358406..7359821
AA seq 471 aa
MIALSLAEIAAVVGGQTYDIPDPAVQVTGPVVRDSREVESGSLFVAFAGERVDGHDFAAA
VVEAGAVAVLASRPVGVPAIVVDDVQTALGALARHVVERLGATLVALTGSAGKTSTKDLI
AQVLRSKAPTVFTPGSLNNEIGLPLTALSATEETKFLVLEMGARGIGHIRYLADLTPPKV
GLVLNVGTAHIGEFGGREQIAQAKGELVEGLPPAEDGGAAILNADDPLVRAMASRTKARV
ILFGESDEADVRAENVRLTAGGQPSFSLHTPSGCSDVTMRLYGEHHVSNALAAAAVAHEL
GMSADEIARALSEAGSLSRWRMEVTERPDGVTVVNDAYNANPESMRAALRALAAMGKGRR
TWAVLGKMAELGDEALAEHDAVGRLAVRLNVGKLVAVGGREASWLQLGAYNEGSWGEESV
HVSDAQAAVDLLRSELRPGDVVLVKASRSVGLESVAQALLETGAEGEVVAR
NT seq 1416 nt   +upstreamnt  +downstreamnt
gtgatcgccctctctctcgccgagatcgcagcagtcgtcggcgggcagacgtacgacata
ccggatccggcggtacaggtcaccggaccggtcgtccgggactcccgtgaggtggagtcc
ggcagcctcttcgtcgccttcgccggtgagcgcgtggacggccacgacttcgcggcagcg
gtcgtggaagcgggcgccgtcgccgttctggcgtcccgccccgtcggggtgcccgcgatc
gtcgtggacgacgtccagacggcgctcggggccctcgcgcgccatgtcgtggagcgcctc
ggcgcgaccctcgtggcgctcaccggctccgcgggcaagaccagcaccaaggacctgatc
gcccaggtgctgagaagcaaggcgccgacggtcttcacgcccggctcgctcaacaacgag
atcgggctgccgctcaccgccctcagcgccaccgaggagacgaagttcctcgtgctggag
atgggcgcccgcggcatcggtcacatccgctacctcgcggatctcacgcctccgaaggtc
ggtctcgtcctcaacgtcggcaccgcccacatcggcgagttcggcggccgcgagcagatc
gcgcaggccaagggcgagctcgtcgagggtcttccgccggcggaggacggcggcgccgcg
atcctgaacgccgacgatccgctcgtccgcgccatggcgtcccgcacgaaggcgcgcgtg
atcctcttcggagagtccgacgaagcggacgtacgcgccgagaacgtccgtctcacggcc
ggcggacagccctcgttcagccttcacacaccctccgggtgcagcgatgtgaccatgcgc
ctgtacggtgagcaccacgtgtcgaacgcgctcgccgcggccgccgtcgcccatgagctg
ggcatgtccgcagacgagatcgcccgtgcgctctccgaggcgggctccctctcccgttgg
cggatggaggtcaccgagcgcccggacggcgtgacggtcgtcaacgacgcctacaacgcg
aaccccgagtccatgcgagccgccctgcgcgcgctcgcggcaatgggcaaggggcggcgg
acctgggcggtgctcggcaagatggccgagctcggggacgaggcgctcgccgagcacgac
gcggtcggacggctcgccgtccggctcaatgtcggcaagctcgtcgcggtcgggggcagg
gaagcgtcctggctgcaactgggcgcatataacgagggttcgtggggtgaggagtcggtg
cacgtgtccgacgcacaggcggctgtcgacctgttgcgcagcgagctgcgcccgggggac
gtcgttctcgtgaaggcgtcccggtcggtcgggctggagagcgttgcacaggcgctgctc
gagaccggtgccgagggtgaggttgtcgcccgatga

DBGET integrated database retrieval system