KEGG   Streptomyces avermitilis: SAVERM_6132
Entry
SAVERM_6132       CDS       T00126                                 
Symbol
lspA
Name
(GenBank) putative signal peptidase II
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_6132 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_6132 (lspA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     SAVERM_6132 (lspA)
Peptidases and inhibitors [BR:sma01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   SAVERM_6132 (lspA)
SSDB
Motif
Pfam: Peptidase_A8
Other DBs
NCBI-ProteinID: BAC73843
NITE: SAV6132
UniProt: Q82AC7
Position
7376393..7376995
AA seq 200 aa
MAEAERIIGTPDIPEAAGAEPEQADGESGGAGAGTERPKGRRRIAVLFAVAALAYAFDLV
SKLIVVAKLEHHAPIEIIGDWLRFEAIRNAGAAFGFGEAFTVIFTVIAAAVIVVIARLAR
KLYSLPWAIALGLLLGGALGNLTDRIFRSPGVFEGAVVDFIAPKHFAVFNLADSAIVCGG
ILIVLLSFRGLDPDGTVHKD
NT seq 603 nt   +upstreamnt  +downstreamnt
gtggcagaggcggagcgcatcatcggtacgccggatatcccagaggcggcgggagccgaa
ccggagcaggccgacggtgagagtggcggtgccggtgccggcaccgagcggcccaagggc
aggcgccggatcgccgtcctgttcgccgtcgccgcgctcgcgtacgccttcgacctcgtc
agcaagctgatcgtggtcgcgaagctggagcaccacgcgccgatcgagatcatcggggac
tggctgaggttcgaggcgatccgcaacgcgggtgcggccttcggcttcggcgaggccttc
accgtcatcttcacggtgatcgcggcggccgtgatcgtggtgatcgcccgcctcgcgcgc
aagctctacagcctgccctgggcgatcgcgctcgggctgctgctcggcggtgcgctgggc
aacctcaccgaccggatcttccgctcgcccggtgtcttcgagggcgcggtcgtcgacttc
atcgcgcccaagcacttcgcggtgttcaacctggcggactcggcgatcgtctgcggcggc
atcctgatcgtgctgctgtccttccgcgggctcgacccggacgggacggtccacaaggac
tga

DBGET integrated database retrieval system