KEGG   Streptomyces avermitilis: SAVERM_6143
Entry
SAVERM_6143       CDS       T00126                                 

Symbol
dnaE1
Name
(GenBank) putative DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_6143 (dnaE1)
   03430 Mismatch repair
    SAVERM_6143 (dnaE1)
   03440 Homologous recombination
    SAVERM_6143 (dnaE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_6143 (dnaE1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6143 (dnaE1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_6143 (dnaE1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_6143 (dnaE1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_6143 (dnaE1)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: BAC73854
NITE: SAV6143
UniProt: Q82AB6
Position
7388156..7391695
AA seq 1179 aa
MSKPPFTHLHVHTQYSLLDGAARLKDMFNACNEMGMTHIAMSDHGNLHGAYDFFHTAKKA
GVTPIIGIEAYVAPESRRNKRKIQWGQPHQKRDDVSGSGGYTHKTIWAANRTGLHNLFKL
SSDAYAEGWLQKWPRMDKETISQWSEGLIASTGCPSGELQTRLRLGQFDEALKSAAEYQE
IFGKDRYFLELMDHGIEIERRVRDGLLEIGKKLGIPPLVTNDSHYTYANEATAHDALLCI
QTGKNLSDPDRFRFDGTGYYLKSTDEMYAIDSSDAWQEGCANTLLVAEQIDTSGMFEAKN
LMPKFDIPEGFTEVTWFQEEVRRGMERRFPGGVPDDRQKQAEYEMDVIIQMGFPGYFLVV
ADFIMWAKKQGIAVGPGRGSAAGSIVAYAMGITDLDPIPHGLIFERFLNPERVSMPDVDI
DFDERRRVEVIRYVTEKYGADKVAMIGTYGKIKAKNAIKDSARVLGYPYAMGDRLTKAMP
ADVLGKGIDLNGITDPSHPRYSEAGEIRAMYENEPDVKKVIDTAKGVEGLVRQMGVHAAG
VIMSSEPIVDHAPIWVRHTDGVTITQWDYPQCESLGLLKMDFLGLRNLTIMDDAVKMVKS
NKGIDLDLLSLPLDDPKTFELLQRGETLGVFQFDGGPMRSLLRLMKPDNFEDISAVSALY
RPGPMGMDSHTNYALRKNGLQEITPIHKELEEPLQEVLAVTYGLIVYQEQVQKAAQIIAG
YSLGEADILRRVMGKKKPDELAKNFVLFQEGAQKKGYSDEAIQALWDVLVPFAGYAFNKA
HSAAYGLVSYWTAYLKANYPAEYMAGLLTSVKDDKDKSAVYLNECRRMGIKVLPPDVNES
MSNFAAQGDDVILFGLSAVRNVGTNVVESIIKSRKAKGKYASFPDYLDKVEAVACNKRTT
ESLIKAGAFDTMGHTRKGLTAQFEPMIDNVVQVKRKEAEGQFDLFGGMGEEESDEPGFGL
DVVFTDDEWEKTYLLAQEREMLGLYVSDHPLFGLEHVLSDKADAGIAQLTGGEHADGAVV
TIGGIISGLQRKMTKQGNAWAIATVEDLAGSLECMFFPATYQLVSTQLVEDAVVFVKGRL
DKREDVPRLVAMELQVPDLSNAGTNAPVILTIPALKVTPPMVSRLGEILSHHKGESEVRI
RLQGPRKTTVLRLDRHRVKPDPALFGDLKVLLGPSCLAG
NT seq 3540 nt   +upstreamnt  +downstreamnt
gtgtcaaagccgccgttcacgcacctgcacgtccacacccagtactcgctgctggacggt
gccgcgcggctcaaggacatgttcaatgcctgcaatgagatgggcatgacacacatcgcc
atgagcgaccacggcaacctccacggggcgtacgacttcttccacacggccaagaaggcg
ggcgtcacgccgatcatcggcatcgaggcgtacgtcgcccccgagtcccggcgcaacaag
cgcaagatccagtggggccagccgcaccagaagcgcgacgacgtgtccggttcgggtggt
tacacgcacaagacgatctgggcggcgaaccggacgggcctgcacaacctcttcaagctc
tcctcggacgcgtacgccgagggctggctccagaagtggccccggatggacaaggagacc
atctcccagtggtccgaaggtctcatcgcctccaccggctgcccctccggcgagctccag
acccggctgcgcctgggccagttcgacgaggccctgaagtcggccgccgagtaccaggag
atcttcggcaaggaccggtacttcctggagctgatggaccacggcatcgagatcgagcgc
cgggtccgtgacggtctcctggagatcggcaagaagctcggcatcccgcccctggtgacg
aacgactcgcactacacctacgcgaacgaggcgaccgcgcacgacgccctgctgtgcatc
cagaccggcaagaacctctccgacccggaccgcttccgcttcgacggcacgggctactac
ctgaagtccacggacgagatgtacgccatcgactcctcggacgcctggcaggagggctgc
gccaacacgctcctggtcgccgagcagatcgacacctccggcatgttcgaggcgaagaac
ctcatgccgaagttcgacatccccgagggcttcaccgaggtcacctggttccaggaggag
gtgcgccgcggcatggagcgccgcttccccggcggcgtccccgacgaccgtcagaagcag
gccgagtacgagatggacgtcatcatccagatggggttcccggggtacttcctcgtggtc
gccgacttcatcatgtgggccaagaagcagggcatcgcggtgggcccgggccgtggttcg
gcggccggctcgatcgtcgcgtacgccatgggcatcaccgacctcgacccgatcccgcac
ggtctgatcttcgagcggttcctcaaccccgagcgcgtctccatgcccgacgtcgacatc
gacttcgacgagcgtcggcgcgtcgaggtgatcaggtacgtgaccgagaagtacggcgcc
gacaaggtcgccatgatcggcacgtacggcaagatcaaggcgaagaacgccatcaaggac
tccgcgcgcgtgctgggctacccgtacgcgatgggcgaccgcctcaccaaggcgatgccc
gccgacgtcctcggcaagggcatcgacctcaacggcatcaccgacccctcgcacccccgc
tacagcgaggccggcgagatccgggcgatgtacgagaacgagccggacgtgaagaaggtc
atcgacaccgccaagggcgtcgagggcctggtccggcagatgggcgtgcacgccgccggc
gtcatcatgtccagcgagcccatcgtcgaccacgcccccatctgggtgcggcacacggac
ggcgtgaccatcacgcagtgggactacccgcagtgcgagtcgctcggcctgctgaagatg
gacttcctcggcctgcgcaacctgacgatcatggacgacgccgtcaagatggtgaagtcc
aacaagggcatcgacctcgacctgctgagcctcccgctcgacgacccgaagaccttcgaa
ctgctccagcgcggcgagaccctcggcgtcttccagttcgacggcggccccatgcgctcg
ctgctgcgcctgatgaagcccgacaacttcgaagacatctccgccgtctcggcgctctac
cgtcccggcccgatgggcatggactcgcacacgaactacgcgctccgcaagaacggcctt
caggagatcacgccgatccacaaggagctggaggagcccctccaggaggtcctggccgtc
acctacggcctgatcgtctaccaggagcaggtgcagaaggccgcccagatcatcgccggg
tactcgctcggcgaggccgacatcctgcgccgcgtgatgggcaagaagaagcccgacgag
ctggcgaagaacttcgtcctcttccaggagggcgcccagaagaagggctacagcgacgag
gccatccaggccctgtgggacgtcctggtgcccttcgccggatacgcgttcaacaaggcg
cactcggccgcgtacggcctggtctcgtactggaccgcgtatctgaaggcgaactacccg
gccgagtacatggccggcctgctcacctcggtcaaggacgacaaggacaagtcggccgtc
tatctgaacgagtgccggcgcatgggcatcaaggtgctcccgccggacgtcaacgagtcg
atgtcgaacttcgccgcgcagggcgacgacgtgatcctcttcggcctgtccgccgtccgt
aacgtcggtacgaacgtcgtcgagtcgatcatcaagagccgcaaggccaagggcaagtac
gcctccttccccgactatctcgacaaggtcgaggcggtcgcctgcaacaagcgcaccacc
gaatcgctgatcaaggcgggcgcgttcgacacgatggggcacacccgcaagggcctcacc
gcgcagttcgagccgatgatcgacaacgtggtgcaggtcaagcgcaaggaggccgagggc
cagttcgacctcttcggcggcatgggcgaggaggagagcgacgagcccggcttcggactc
gacgtcgtcttcaccgacgacgagtgggagaagacctatctgctcgcccaggagcgggag
atgctcggtctgtacgtctccgaccacccgctcttcggcttggagcacgtgctgtccgac
aaggccgacgcgggcatcgcccagctcaccggaggcgagcacgcggacggcgcggtcgtc
accatcggcggcatcatctcgggcctccagcgcaagatgaccaagcagggcaacgcgtgg
gcaatcgccaccgtggaggacctggcgggctccctggagtgcatgttcttcccggccacg
taccagctggtgtcgacccaactcgtcgaggacgcggtcgtgttcgtcaagggacgcctc
gacaagcgcgaggacgtgccccggctcgtcgccatggagctccaggtccccgacctgtcg
aacgcgggcaccaacgcgcccgtgatcctcaccattccggcgctgaaggtcaccccgccg
atggtgagccggctcggtgagatcctcagccaccacaagggcgagagcgaggtgcggatc
agactccagggtccgcgcaagacgaccgtgctgcggctcgaccggcaccgggtgaagccg
gatccggccctgttcggcgatctgaaggtgctgctcggcccgtcctgcctggcgggctga

DBGET integrated database retrieval system