KEGG   Streptomyces avermitilis: SAVERM_6171
Entry
SAVERM_6171       CDS       T00126                                 
Symbol
trpE
Name
(GenBank) putative anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
sma  Streptomyces avermitilis
Pathway
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00405  Phenazine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
sma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_6171 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SAVERM_6171 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_6171 (trpE)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SAVERM_6171 (trpE)
SSDB
Motif
Pfam: Chorismate_bind Anth_synt_I_N Phage_holin_3_1
Other DBs
NCBI-ProteinID: BAC73882
NITE: SAV6171
UniProt: Q82A88
Position
7417784..7419265
AA seq 493 aa
MDLETFRKLATDRRVIPVSRKLLADGDTPVGLYRKLAAERPGTFLLESAENGRSAFKWSR
YSFVGVRSAATLTERDGQAHWLGTPPVGVPTDGDPLAALRATIEALHTPHEEGLPPFTGG
MVGYLGYDIVRRLEKIGPGERDDLKLPELTMLLTSDLAVMDHWEGSVLLIANAINHNDLD
TGVDEAYADAVARLDAMEADLSRAVAQPPAALPPSELPEYTALWGGPDFQDAVEDIKERI
RAGEAFQVVPSQRFETPCTASALDVYRVLRATNPSPYMYLFRFEGFDVVGSSPEALVKVE
DGQAMVHPIAGTRPRGATPQEDQALADELLADPKERAEHLMLVDLGRNDLGRVCEPGSVE
VVDFMTIERYSHVMHIVSTVTGRVARGRTAFDVLTACFPAGTLSGAPKPRALQIIDELEP
SRRGLYGGCVGYLDFAGDSDTAIAIRTALLRDGTAYVQAGAGIVADSDPVAEDDECRNKA
AAVLRAVHTANRL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggacctcgagacgttccgcaagctggccaccgaccgccgtgtcattcccgtcagccgc
aaactcctcgccgacggcgacaccccggtcgggctctaccgcaagctcgccgccgagcgc
cccggcaccttcctcctggagtccgcggagaacggccgctcggcgttcaaatggtcccgc
tactccttcgtgggcgtccgctccgccgccaccctcaccgagcgtgacgggcaggcgcac
tggctcggcaccccgcccgtgggcgtccccacggacggcgacccgctcgccgccctgcgc
gccaccatcgaggcgctgcacacgccccacgaggagggcctgccgcccttcaccggcggc
atggtcggctatctcggctacgacatcgtgcgccgcctggagaagatcggccccggcgag
cgcgacgatctgaaacttcccgagctgaccatgctcctcaccagcgatctggccgtcatg
gaccactgggagggctccgtcctgctgatcgccaacgcgatcaaccacaacgacctcgac
acgggcgtcgacgaggcctacgcggacgcggtcgcccgcctcgacgccatggaggcggac
ctgtcgcgcgcggtcgcgcagccccccgccgccctcccgccctccgaactcccggagtac
accgccctctggggcggccccgacttccaggacgccgtcgaggacatcaaggagcgcatc
cgggcgggcgaggcgttccaggtcgtcccctcccagcgcttcgaaacgccgtgcacggca
agcgcgttggacgtctaccgggtactgcgggcgaccaacccctcaccgtacatgtacctc
ttccgcttcgagggcttcgacgtggtcggctcgtcccccgaggccctcgtcaaggtcgag
gacgggcaggcgatggtccaccccatcgcgggcacccggccgcgcggcgcgaccccgcag
gaggaccaggccctcgcggacgagctgctggccgaccccaaggagcgcgccgagcacctg
atgctcgtcgacctggggcgcaacgatctggggcgggtctgcgagcccggttccgtcgag
gtcgtcgacttcatgaccatcgagcgctactcgcacgtgatgcacatcgtgtcgaccgtg
accgggcgggtcgcgcgggggcgtacggccttcgacgtgctgacggcctgcttcccggcc
ggcaccctctccggcgcgcccaagccccgcgccctgcagatcatcgacgaactggagccg
tcccggcgggggctgtacggcggctgcgtcggctacctcgacttcgcgggcgactccgac
accgccatcgccatccgcacggcgctgctgcgcgacggcacggcgtacgtgcaggcgggc
gccggcatcgtcgcggactcggacccggtcgccgaggacgacgagtgccgcaacaaggcg
gcggcggtcctgcgcgcggtccacacggcgaaccggctgtag

DBGET integrated database retrieval system