KEGG   Streptomyces avermitilis: SAVERM_6202
Entry
SAVERM_6202       CDS       T00126                                 
Symbol
cotA
Name
(GenBank) putative coenzyme A transferase, subunit A
  KO
K01039  glutaconate CoA-transferase, subunit A [EC:2.8.3.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00643  Styrene degradation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_6202 (cotA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SAVERM_6202 (cotA)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.12  glutaconate CoA-transferase
     SAVERM_6202 (cotA)
SSDB
Motif
Pfam: CoA_trans Herpes_UL47
Other DBs
NCBI-ProteinID: BAC73913
NITE: SAV6202
UniProt: Q82A57
Position
complement(7451548..7452396)
AA seq 282 aa
MSDKTMTADEAVSRLRSGMTLGIGGWGSRRKPMALVRALLRSGITDLTVVSCGGPDVGML
AAAGRIRKLVAAFVTLDSIPLEPHYRAARERGALELMEIDEAMFLWGLRAAAGRLPFLPV
RAGIGSDVMRVNPGLRTITSPYVDGETFVAMPALRLDAALVHLNRADRLGNGQYLGPDPY
FDDLFCEAADTAYVSCERVVDTAELTKEAAPQTLLVKRHTVTGVVEAPNGADFTSCVPDY
GRDEALQRYYATTPWPEFAERFLGGGEPAYRSAVQDWRKERI
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgagtgacaagaccatgaccgccgacgaggccgtctcccgcctgcggagcggtatgacc
ctcggcatcggcggctggggttcgcgccgcaagccgatggccctggtgcgagcactgctc
cgctccgggatcaccgatctcaccgtcgtctcgtgcggcggcccggacgtcggcatgctc
gcggccgccgggcggatacggaaactggtcgccgccttcgtgaccctcgactcgatcccg
ctcgaaccgcactaccgcgcggcacgcgagcgcggggcgctggagctgatggagatcgac
gaggcgatgttcctgtggggactgcgcgcggcggccggtcggctcccctttctgccggtg
cgggcgggcatcggctccgacgtgatgcgggtcaaccccggcctgcggacgatcacttcg
ccgtacgttgacggggagaccttcgtcgcgatgcccgccctgcggctggacgcggcgctg
gtgcatctgaaccgcgcggaccgcctcggcaacggccagtacctgggcccggacccgtac
ttcgacgacctgttctgcgaggcggccgacacggcgtacgtctcctgcgagcgggtcgtc
gacacggcggagctgacgaaggaggcggcaccgcagacgctcctggtgaagcggcacacg
gtgacgggcgtcgtggaggcgccgaacggcgcggacttcacctcctgcgtacccgactac
ggccgggacgaggccctccagaggtactacgcgaccacgccgtggccggagttcgccgag
cggttcctcggcggcggcgaaccggcctaccggtccgcggtccaggactggcgcaaggag
cggatatga

DBGET integrated database retrieval system