KEGG   Streptomyces avermitilis: SAVERM_6227
Entry
SAVERM_6227       CDS       T00126                                 
Symbol
polA1
Name
(GenBank) putative DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03410  Base excision repair
sma03420  Nucleotide excision repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_6227 (polA1)
   03410 Base excision repair
    SAVERM_6227 (polA1)
   03420 Nucleotide excision repair
    SAVERM_6227 (polA1)
   03440 Homologous recombination
    SAVERM_6227 (polA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_6227 (polA1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6227 (polA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_6227 (polA1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SAVERM_6227 (polA1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     SAVERM_6227 (polA1)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_6227 (polA1)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1 DNA_pol_lambd_f HHH_5 HHH_2
Other DBs
NCBI-ProteinID: BAC73938
NITE: SAV6227
UniProt: Q82A32
Position
7481798..7484521
AA seq 907 aa
MAETASKKTEKTSGGARPRLMLMDGHSLAYRAFFALPAENFTTATGQPTNAIYGFASMLA
NTLRDEAPTHFAVAFDVSRKTWRSEEFTEYKANRSKTPDEFKGQVELIGELLDAMHAQRF
AVDGFEADDIIATLATQAEAEGFEVLIVTGDRDSFQLVSDHTTVLYPTKGVSELTRFTPE
KVFEKYGLTPAQYPDFAALRGDPSDNLPGIPGVGEKTAAKWINQFGSFAELVERVDEVKG
KVGQNLRDHLESVKLNRRLTEMVRDVELPKSVAALERAPYDRTAVAMVLDTLEIRNPSLR
ERLLAVDPGGEEAEEAPVAAGVAVDGAVLGAGELKPWLAEHGTTVLGLATVDSWALGAGA
VAEVALAAADGAAAWFDPSQLDEADENAFATWLADPAKPKVLHNAKGVMRVFAEHGWTVE
GVSMDTALAAYLVKPGRRSFALDALSLEYLGRELEPAATADGQLAFGADEGAEADALMVQ
ARAILDLGEAFGERLKEVGSADLLRDMELPTSALLARLERHGIAADKAHLEAMEQMFAGA
VQQAVKEAHAAAGHEFNLGSPKQLQEVLFGELGLPKTKKTKTGYTTDADALAWLAAQTDN
ELPVIMLRHREQAKLRVTVEGLIKTIAADGRIHTTFNQTVAATGRLSSTDPNLQNIPVRT
DEGRAIRRGFVVGEGFESLMTADYSQIELRVMAHLSEDEGLIEAFTSGEDLHTTVASQVF
GVERSAVDAEMRRKIKAMSYGLAYGLSAFGLSQQLNIDAGEARALMDTYFERFGGVRDYL
RRAVDEARATGYTETLFGRRRYLPDLNSDNRQRRETAERMALNAPIQGTAADIVKIAMLN
VDRALQEANLKSRMLLQVHDEIVLEIAPGERAKTEELVRREMASAVQLRAPLDVSVGDGG
DWESAAH
NT seq 2724 nt   +upstreamnt  +downstreamnt
gtggcagaaacagcatcgaagaagaccgagaagacctccggcggcgcgcgtccgcggctg
atgctcatggacgggcactcgctggcgtaccgcgcgttcttcgcgctgcccgcggagaac
ttcacgaccgcgaccggccagccgacgaacgcgatctacggcttcgcgtcgatgctggcg
aacacgctgcgcgacgaggcgcccacgcacttcgcggtggcgttcgacgtctcgcgcaag
acgtggcgctccgaggagttcacggagtacaaggcgaaccgctccaagaccccggacgag
ttcaaggggcaggtcgagctgatcggtgagctgctcgacgcgatgcacgcgcagcggttc
gcggtcgacggcttcgaggcggacgacatcatcgccacgctcgccacgcaggccgaggcc
gagggcttcgaggtcctcatcgtcaccggtgaccgggactccttccagctggtcagcgat
cacacgacggtgctgtatccgacgaagggcgtctcggagctgacccggttcaccccggag
aaggtcttcgagaagtacgggttgacgcccgcgcagtacccggacttcgcggcgctgcgc
ggcgacccgtccgacaacctgccgggcatcccgggcgtcggcgagaagaccgcggccaag
tggatcaaccagttcggttcgttcgcggagctggtcgagcgcgtcgacgaggtcaagggc
aaggtcggccagaacctccgcgaccacctggagtcggtgaagctgaaccgccggctcacg
gagatggtgcgggacgtcgagctgccgaagtcggtcgccgccctggagcgcgctccgtac
gaccgcacggccgtcgcgatggtcctggacaccctggagatccgcaacccgtccctgcgc
gagcggctgctggccgtcgacccgggcggggaggaggccgaggaggcgccggtcgccgcg
ggcgtcgcggtggacggcgcggtgctgggcgcgggcgagctgaagccgtggctcgccgag
cacggcacgacggtcctggggctggccacggtcgactcctgggcgctcggcgcgggtgcg
gtggccgaggtcgcgctcgccgcggccgacggggcggccgcctggttcgacccgtcccag
ctggacgaggccgacgagaacgcgttcgcgacgtggctcgccgaccccgcgaagcccaag
gtgctgcacaacgccaagggtgtgatgcgggtcttcgccgagcacggctggaccgtcgag
ggcgtgtccatggacaccgcgctcgccgcctacctggtcaagccgggccgccgctccttc
gcgctggacgcgctgtccctggagtacctcggccgtgagctggagcccgccgcgacggcc
gacgggcagctggccttcggcgcggacgagggggccgaggccgacgcgctgatggtgcag
gcgcgcgcgatcctcgacctgggcgaggcgttcggcgagcggttgaaggaggtcggctcg
gccgacctgctccgcgacatggagctgccgacgtccgccctgctggcccggctggagcgg
cacggcatcgcggcggacaaggcccacctggaggccatggagcagatgttcgcgggcgcc
gtgcagcaggcggtgaaggaggcgcacgcggccgcgggacacgagttcaacctgggctcg
cccaagcagctccaggaagtcctcttcggtgaactgggcctgcccaagacgaagaagacg
aagacgggctacacgacggacgcggacgcgctggcgtggctggccgcccagacggacaac
gaactgccggtgatcatgctccgtcaccgtgagcaggcgaagctgcgggtgacggtcgag
ggcctgatcaagacgatcgcggcggacggccgcatccacaccacgttcaaccagacggtg
gcggcgaccggtcggctgtcgtcgaccgacccgaaccttcagaacatcccggtgcgcacc
gacgagggccgcgcgatccgccgcggcttcgtggtcggcgagggcttcgagtcgctgatg
accgcggactacagccagatcgagctgcgtgtgatggcccacctgtccgaggacgagggc
ctgatcgaggcgttcacctccggagaggacctgcacacgacggtcgcctcccaggtgttc
ggggtggagcgctcagcggtggacgcggagatgcgccgcaagatcaaggcgatgtcgtac
ggcctcgcgtacggcctgtcggccttcggtctctcgcagcagctgaacatcgatgcgggc
gaggcgcgggcgctgatggacacgtacttcgagcgcttcggaggagtacgcgactatctg
cgccgcgcggtcgacgaggcgcgggcgacgggctacacggagacgctgttcggccgccgc
cgctacctcccggacctgaacagcgacaaccgccagcgccgcgagacggcggagcgcatg
gcgttgaacgcgccgatccagggcaccgcggcggacatcgtcaagatcgccatgctgaac
gtggaccgcgcgctccaggaggcgaacctcaagtcccgcatgctcctccaggtccacgac
gaaatcgtcctggagatcgcgccgggcgagcgggcgaagacggaggaactggtccgccgg
gagatggcgtccgccgtgcagctgagggctccgctggatgtctcggtgggcgacggcggg
gactgggagtcggcggcgcactag

DBGET integrated database retrieval system