KEGG   Streptomyces avermitilis: SAVERM_6242
Entry
SAVERM_6242       CDS       T00126                                 
Name
(GenBank) hypothetical protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_6242
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6242
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SAVERM_6242
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_6242
SSDB
Motif
Pfam: UDG HEAT_PBS
Other DBs
NCBI-ProteinID: BAC73953
NITE: SAV6242
UniProt: Q82A17
Position
7500537..7501331
AA seq 264 aa
MEGTEGRDSSLAEGGRLAEGSSLSDLDEHITGCRACPRLVEWREEVARTKRAAFADWTYW
GRPVPGFGPVDASLLVVGLAPAAHGANRTGRMFTGDRSGDVLYAALHDVGLASRATAVSA
DDGLELYGVRITSPVHCAPPANKPTPEERDTCRPWLVRELELLRPTLRAVVVLGAFGWQA
ALPALAEAGWAVPRPRPAFAHGVRVTLRPSAGPPAKSLDVLGCFHVSQRNTFTGRLTPAM
LRDVLRTAAEAAGLPTLPDAGQYA
NT seq 795 nt   +upstreamnt  +downstreamnt
atggagggcacggagggcagggacagcagcttggcggagggcggccgcctggcggagggc
agcagcctgagtgacctggacgagcacatcacggggtgccgtgcctgcccgcggctggtc
gagtggcgcgaagaggtggcccgtaccaagcgcgccgctttcgccgactggacgtactgg
ggacgtccggtcccgggtttcgggcccgtggacgcctcgctcctcgtcgtcgggctcgca
cccgccgcgcacggggccaaccggaccgggcggatgttcaccggggacaggtcgggggac
gttctgtacgcggcactgcacgacgtgggtctcgcctcgcgggccaccgccgtgtccgcc
gatgacggccttgagctgtacggggtgcggatcacctcgcccgtgcactgcgcgccgccc
gccaacaagccgacgccggaggagcgggacacctgtcggccctggctggtgcgtgaactc
gagctgctgcggccgacgttgcgggccgtcgtggtgctcggcgccttcggctggcaggcc
gcgctgcccgccctcgccgaggcggggtgggcggtgccacggccccggccggccttcgcg
cacggggtgcgggtgacgctccggccctcagcagggccgcccgccaagtcgctcgacgtc
ctcgggtgtttccacgtcagccagcgcaacaccttcaccggacggctgacgcccgccatg
ctgcgggacgtgctgcgtacggcggcggaggcggcggggctgccgacactgccggatgcg
gggcagtacgcctaa

DBGET integrated database retrieval system