KEGG   Streptomyces avermitilis: SAVERM_6273
Entry
SAVERM_6273       CDS       T00126                                 
Symbol
uvrB
Name
(GenBank) putative excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_6273 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6273 (uvrB)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_6273 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SAVERM_6273 (uvrB)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD Helicase_RecD AAA_5 DUF87 AAA_22 AAA_7 AAA_16 AIG1
Other DBs
NCBI-ProteinID: BAC73984
NITE: SAV6273
UniProt: Q829Y6
Position
7528431..7530572
AA seq 713 aa
MRPVSKIERTVAPFEVVSPYQPSGDQPAAIAELDRRIRAGEKDVVLLGATGTGKSATTAW
MIEKLQRPTLVMAPNKTLAAQLANEFRELLPNNAVEYFVSYYDYYQPEAYVPQSDTYIEK
DSSINEEVERLRHSATNSLLTRRDVVVVASVSCIYGLGTPQEYVDRMVPLRVGDEVDRDD
LLRRFVDIQYTRNDLAFTRGTFRVRGDTIEIFPVYEELAVRIEMFGDEIEALSTLHPLTG
EIISDDQHLYVFPASHYVAGPERLERAANDIEKELGERLTELEKQGKLLEAQRLRMRTTY
DLEMLRQIGSCSGVENYSMHFDGREPGSPPNTLLDYFPDDFLLVIDESHVTVPQIGAMYE
GDASRKRTLVDHGFRLPSALDNRPLKWEEFQERIGQAVYLSATPGKYELSRGDGFVEQII
RPTGLIDPEVVVKPTEGQIDDLVHEIRKRTEKDERVLVTTLTKKMAEDLTDYFLELGIQV
RYLHSDVDTLRRVELLRELRAGEYDVLVGINLLREGLDLPEVSLVAILDADKEGFLRSGT
SLIQTIGRAARNVSGQVHMYADKITPAMEKAIDETNRRREKQVAYNKEKGIDPQPLRKKI
NDIVAQIAREDIDTEQLLGSGYRQAKDGKGAKAPVPSLGGKAAAKGAKSAKGKAKETVPT
DRPAAKLAEEIEELTNRMRAAAADLQFEIAARLRDEVSEMKKELRQMKEAGLA
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgcggcccgtttccaagatcgaacgcacggtggcgcccttcgaggtcgtcagtccctac
cagcccagcggcgaccagccggcggccatcgctgagctcgaccgacgtatccgtgcaggt
gagaaggacgtcgtcctgctcggcgcgaccggcaccggcaagtccgccaccaccgcgtgg
atgatcgagaagctccagcgccccaccctcgtgatggcgccgaacaagacactggccgcc
cagctggccaacgagttccgcgagctgctgccgaacaacgccgtcgaatacttcgtctcg
tactacgactactaccagcccgaggcgtacgtcccgcagtcggacacctacatcgagaag
gactcctcgatcaacgaggaggtcgagcgcctgcgccactccgcgaccaactcgctgctc
acccgccgcgatgtcgtcgtggtcgcctcggtctcctgcatctacggcctgggtactccg
caggagtacgtggaccggatggtcccgctcagggtcggcgacgaggtcgaccgcgacgac
ctgctgcgccgcttcgtcgacatccagtacacgcgcaacgacctggccttcacccggggc
accttccgggtccgcggcgacaccatcgagatcttcccggtctacgaggagctggccgtc
cgcatcgagatgttcggcgacgagatcgaggcgctctccaccctgcacccgctcaccggc
gagatcatcagcgacgaccagcatctgtacgtcttcccggcctcccactacgtcgcgggc
cccgaacgcctggagcgggccgccaacgacatcgagaaggagctgggggagcgcctcacc
gagctggagaagcagggcaagctcctggaggcccagcgcttgaggatgcggacgacgtac
gacctcgagatgctccgccagatcgggtcctgctccggcgtcgagaactactcgatgcac
ttcgacggccgcgagcccggctccccgccgaacacgctgctcgactacttcccggacgac
ttcctgctcgtcatcgacgagtcgcacgtcaccgtgccgcagatcggcgccatgtacgaa
ggagacgcctcccgcaagcgcaccctcgtcgaccacggcttccgcctgccttccgccctg
gacaaccgccccctgaagtgggaggagttccaggagcgcatcggccaggccgtctatctg
tcggcgacgccgggcaagtacgagctctcgcgcggggacggtttcgtcgagcagatcatc
cgccccaccggcctcatcgaccccgaggtcgtggtcaagcccaccgagggccagatcgac
gatctggtgcacgagatccgcaagcgcaccgagaaggacgagcgcgtcctggtcaccacg
ctcaccaagaagatggccgaggacctcaccgactacttcctcgaactgggcattcaggtc
cgctacctgcacagcgacgtcgacaccctgcgccgcgtcgagctgctgcgcgaactgcgc
gccggtgagtacgacgtactggtcggcatcaacctgctgcgtgagggcctcgacctgccc
gaggtctccctggtggcgatcctcgacgccgacaaggagggcttcctgcgctccggaacg
tcgctgatccagaccatcggccgcgcggcgcgcaatgtgtccggccaggtccacatgtac
gccgacaagatcaccccggcgatggagaaggcgatcgacgagaccaatcgccgccgggag
aagcaggtcgcgtacaacaaggagaagggcatcgacccgcagccactccgcaagaagatc
aacgacatcgtggcgcagatcgcccgcgaggacatcgacacggagcaactgctcggctcg
ggctatcgccaggcgaaggacggcaagggcgcgaaggcaccggtgccgtcactcggcgga
aaggcggcggccaagggcgccaagtccgccaagggcaaggccaaggagacggtgccgacc
gaccgtccggcggcgaaactcgccgaggagatcgaggaactgaccaaccgcatgcgcgcc
gccgcggccgaccttcagttcgagatcgcggcccggctgcgtgacgaggtctccgagatg
aagaaggagctgcggcagatgaaggaggcgggcctggcctga

DBGET integrated database retrieval system