KEGG   Streptomyces avermitilis: SAVERM_6286
Entry
SAVERM_6286       CDS       T00126                                 
Symbol
uvrA1
Name
(GenBank) putative excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_6286 (uvrA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6286 (uvrA1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_6286 (uvrA1)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SAVERM_6286 (uvrA1)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase AAA_21 AAA_23 AAA_33 AAA_25 AAA_22 DUF4350 DnaJ_CXXCXGXG APS_kinase NACHT cobW ATPase Viral_helicase1
Other DBs
NCBI-ProteinID: BAC73997
NITE: SAV6286
UniProt: Q829X3
Position
7543816..7546845
AA seq 1009 aa
MADRLIVRGAREHNLKNVSLDLPRDSLIVFTGLSGSGKSSLAFDTIFAEGQRRYVESLSS
YARQFLGQMDKPDVDFIEGLSPAVSIDQKSTSRNPRSTVGTITEVYDYLRLLFARIGKPH
CPECGRPISRQSPQAIVDKVLELPEGSRFQVLSPLVRERKGEFVDLFADLQTKGYSRARV
DGQTIQLSDPPTLKKQEKHTIEVVIDRLTVKEGAKRRLTDSVETALGLAGGMVVLDFVDL
PEDDPERERMYSEHLYCPYDDLSFEELEPRSFSFNSPFGACPDCSGIGTRMEVDAELIVP
DEEKSLDEGAIHPWSHGHTKDYFGRLIGALADALGFRTDIPFAGLPQRAKKALLYGHKTQ
IEVRYRNRYGRERVYTTPFEGAVPFVKRRHSEAESDASRERFEGYMREVPCPTCQGTRLK
PLVLAVTVMEKSIAEVAAMSISDCADFLGKLKLNARDKKIAERVLKEVNERLRFLVDVGL
DYLSLNRAAGTLSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNHRLIETLVRLR
DMGNTLIVVEHDEDTIKVADWIVDIGPGAGEHGGKVVHSGSLKELLANAESQTGQYLSGK
KSIPLPDIRRPRDPSRQLTVHGARENNLQDIDVSFPLGVLTAVTGVSGSGKSTLVNDILY
THLARELNGARSVPGRHTRVDGDDLVDKVVHVDQSPIGRTPRSNPATYTGVFDHVRKLFA
ETTEAKVRGYLPGRFSFNVKGGRCENCSGDGTIKIEMNFLPDVYVPCEVCHGARYNRETL
EVHYKGKSIADVLNMPIEEAMHFFEAVPAIARHLNTLNDVGLGYVRLGQSATTLSGGEAQ
RVKLASELQRRSTGRTVYVLDEPTTGLHFEDISKLLVVLSGLVDKGNTVIVIEHNLDVIK
TADWVVDMGPEGGAGGGLVVAEGTPEEVAGVPTSHTGKFLREILDADRISDAASVKAPRK
TAARKTAAAKSTTKKTATVRTTNNTATKKAAAVTKKTAPAKKTTRARKA
NT seq 3030 nt   +upstreamnt  +downstreamnt
gtggccgaccgtctcatcgtccgtggcgcgcgcgagcacaacctcaagaatgtctcgctc
gacctgccacgcgactcgctcatcgtcttcacgggcctgtctgggtcgggcaagtcctcg
ctggccttcgacacgatcttcgccgaggggcagcgccgctacgtcgagtcgctctcgtcg
tacgcccggcagttcctcggccagatggacaagccggacgtggacttcatcgagggcctc
tccccggcggtctccatcgaccagaagtcgacctcgcgcaacccgcgctcgacggtcggc
accatcacagaggtttacgactatctgcgtctgctgttcgcgcgcatcggcaagccgcac
tgccccgagtgcggccgcccgatctcgcgccagtcgccgcaggccatcgtcgacaaggtc
ctggagctgccggagggcagccgcttccaggtcctgtcgcccctggtgcgcgaacgcaag
ggagagttcgtcgacctgttcgccgatctccagaccaagggatacagccgtgcccgggtc
gacggccagacgatccagctcagcgacccgcccacgctgaagaagcaggagaagcacacc
atcgaggtggtcatcgaccgcctcacggtgaaggaaggcgccaagcgccgcctcacggac
tccgtggagaccgccctcggcctggccggtggcatggtcgtgctcgacttcgtcgacctc
cccgaggacgaccccgagcgcgagcgcatgtactcggagcacctgtactgcccgtacgac
gacctgtccttcgaggagctggagccccgctccttctccttcaactcgccgttcggcgcc
tgccccgactgctccggcatcggtacgcgcatggaggtcgacgccgagctgatcgtcccg
gacgaggagaagtccctcgacgagggcgccatccacccctggtcgcacggacacaccaag
gactacttcggccggctgatcggggccctcgcggacgcgttgggattccggaccgacatc
cccttcgccggtctcccgcagcgcgccaagaaggcactgctttacggccacaagacccag
atcgaggtccgctaccgcaaccggtacgggcgcgagcgtgtgtacaccacgcccttcgaa
ggggccgtccccttcgtcaagcggcggcacagcgaggccgagagcgacgcgagccgcgag
cgcttcgagggctatatgcgcgaggtcccctgtcccacctgccagggcacgcgtctgaag
ccgctcgtcctcgcggtcacggtcatggagaagtcgatcgccgaggtcgcggcgatgtcc
atcagcgactgcgcggacttcctgggcaagctgaagctcaacgcccgcgacaagaagatc
gccgaacgcgtcctgaaggaggtcaacgagcggctgcgcttcctggtcgacgtcggcctc
gactacctgtcgctgaaccgcgcggccggcaccctgtccggcggcgaggcccagcgcatc
cgcctggccacgcagatcggctccggcctcgtcggcgtcctgtacgtcctcgacgagccg
tccatcggtctgcaccagcgcgacaaccaccggctgatcgagaccctggtccggctgcgc
gacatgggcaacacgctcatcgtcgtggagcacgacgaggacaccatcaaggtcgccgac
tggatcgtcgacatcggccccggtgcgggcgagcacggcggcaaggtcgtgcacagtggc
tccctgaaggagctgctggccaacgccgagtcgcagaccggccagtacctgtccggcaag
aagtccatccccctgcccgacatccgacgcccgcgcgacccgtcccggcagctcacggtg
cacggcgcccgtgagaacaacctccaggacatcgacgtgtcgttcccgctgggcgtcctc
actgccgtcacgggcgtgtccggctccggcaagtcgacgctggtcaacgacatcctgtac
acacacctggcccgcgagctgaacggcgcgaggagcgtccccggccgacacacgcgcgtg
gacggcgacgacctcgtcgacaaggtggtgcacgtcgaccagtcgcccatcggccgcacc
ccccggtccaacccggccacgtacaccggagtcttcgaccacgtccgcaagctgttcgcg
gagacgaccgaggcgaaggtgcgcggctatctgcccggacgcttctccttcaacgtcaag
ggcggtcgctgtgagaactgctccggtgacggcaccatcaagatcgagatgaacttcctg
ccggacgtgtacgtcccgtgcgaggtctgccacggagcgcgctacaaccgggagaccctg
gaggtccactacaagggcaagtccatcgccgacgtcctgaacatgccgatcgaggaggcc
atgcacttcttcgaggccgtcccggcgatcgcccgccatctgaacacgctgaacgacgtc
ggcctcggctacgtccgcctcggccagtccgcgacgaccctgtccggcggcgaggcgcag
cgcgtgaagctggccagcgagctccagcggaggtccaccggaagaacggtgtacgtcctc
gacgagccgaccaccggtctccacttcgaggacatcagcaagctcctcgtcgtgctctcc
gggctggtcgacaagggcaacacggtcatcgtcatcgagcacaacctcgacgtcatcaag
accgcggactgggtcgtcgacatgggccccgagggcggcgccggcggcggtctcgtcgtc
gccgagggcacgccggaggaggtcgccggggtgccgacgagccacaccggcaagttcctg
cgcgagattctcgacgccgatcgcatcagcgacgcggcgtccgtgaaggccccgcgcaag
acggccgccaggaagacggcagcggccaagtcgacgacgaagaagacggcgacggtcagg
accaccaacaacacggccaccaagaaggcggccgccgtgacgaagaagaccgcccccgcg
aagaagaccacgcgggcgcgcaaggcctga

DBGET integrated database retrieval system