KEGG   Streptomyces avermitilis: SAVERM_6291
Entry
SAVERM_6291       CDS       T00126                                 
Symbol
uvrC
Name
(GenBank) putative excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_6291 (uvrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6291 (uvrC)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_6291 (uvrC)
SSDB
Motif
Pfam: UvrC_RNaseH_dom UVR GIY-YIG HHH_5 HHH_2 HHH MciZ GIY_YIG_domain CorA
Other DBs
NCBI-ProteinID: BAC74002
NITE: SAV6291
UniProt: Q829W8
Position
7551262..7553307
AA seq 681 aa
MADPSSYRPKPGEIPDSPGVYKFRDEHHRVIYVGKAKSLRQRLASYFQDLAGLHPRTRTM
VTTAASVEWTVVSTEVEALQLEYSWIKEYDPRFNVKYRDDKSYPYLAVTMNEEFPRVQVM
RGHKRKGVRYFGPYGHAWAIRDTVDLLLRVFPVRTCSAGVFKNAARTGRPCLLGYIGKCS
APCVERVSAEEHRELAEEFCDFMAGRTGTYIRRLERQMTDAAEEMEYEKAARLRDDIGAL
KKAMEKNAVVLADATDADLIAVAEDELEAAVQIFHVRGGRVRGQRGWVTDKVEAVTTADL
VEHALQQLYGEETGDSVPKEVLVPALPDPVEPVQEWLTGRRGSIVSLRIPQRGDKKSLME
TVQRNAQQSLALHKTKRASDLTTRSRALEEIAEALDLDSAPLRIECYDISHLQGDDVVAS
MVVFEDGLQRKSEYRRFQIKSFEGQDDVRSMHEVITRRFRRYLSEKERTGEWADGDLKDG
ELKDDEGRPKRFAYPPQLVVVDGGQPQVAAAKRALDELGIDDIAVCGLAKRLEEVWLPDD
GDPVVLPRTSEGLYLLQRVRDEAHRFAITYQRTKRAKRFRASPLDDVAGLGETRKQALIK
HFGSVKKLRSATIDQICEVPGIGRKTAETIAVAFAQAAPAVPAVNTATGEIMEDEEPGTT
AGSSQEPVSAGTSDERRGQET
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggccgacccctccagctaccgccccaagccgggagagatcccggactcacccggggtc
tacaaattccgcgacgagcaccaccgggtgatctacgtcgggaaggcgaagagcctgcgc
cagcgcctggcgagctacttccaggacctggcgggcctccacccgcgcacccgcaccatg
gtcaccacagcggcgtccgtggagtggacggtggtgtccacggaggtcgaggcgctgcag
ctggagtactcctggatcaaggagtacgacccccggttcaacgtcaagtaccgcgacgac
aagagctacccgtacctcgccgtgacgatgaacgaggagttcccgcgggtgcaggtgatg
cgcggccacaagcgcaagggcgtgcggtacttcgggccgtacgggcacgcgtgggcgatc
cgcgacaccgtcgacctgctgctgcgcgtcttccccgtccgtacctgctcggccggcgtc
ttcaagaacgccgcccgcaccggccgcccctgcctcctcggctacatcggcaagtgctcg
gcgccctgcgtggagcgcgtctccgccgaggagcaccgtgaactcgccgaggagttctgc
gacttcatggcaggccgcacgggtacgtacatccgccgcctggagcggcagatgacggac
gcggccgaggagatggagtacgagaaggccgctcggctgcgcgacgacatcggggccctg
aagaaggccatggagaagaacgcggtcgtgctcgccgacgcgaccgacgcggacctgata
gcggtcgccgaggacgagctggaagcggccgtgcagatcttccacgtacgcggcggacgc
gtacgcggccagcgcggctgggtcaccgacaaggtcgaggccgtcaccaccgcggatctc
gtcgagcacgccctccagcagctctacggcgaggagaccggcgactccgtgcccaaggag
gttctcgtccccgcgctgcccgaccccgtggagcccgtccaggaatggctcaccgggcgc
cgcggatcgatcgtgtcgctgcgcattccgcagcgcggcgacaagaagtccctgatggag
accgtgcagcgcaacgcccagcagtcgctcgcgctgcacaagaccaagcgcgcctccgac
ctgaccacccgctcgcgcgccctggaggagatcgccgaggcgctcgacctggacagcgcg
cccctcaggatcgagtgctacgacatctcgcatctccagggcgacgacgtcgtggcctcc
atggtggtcttcgaggacggactccagcgcaagagcgagtaccggcgcttccagatcaag
agcttcgaaggccaggacgacgtccgctccatgcacgaggtgatcacccgccgcttcagg
cgctacctctccgagaaggagaggaccggcgagtgggccgacggtgacctgaaggacggt
gagctgaaggacgacgagggccgccccaagcgcttcgcctacccgccgcagctggtcgtc
gtcgacggcggccagccccaggtcgcggccgccaagagggcgctcgacgagctcggcatc
gacgacatcgccgtctgcggcctcgccaagcgtctggaggaggtctggctgccggacgac
ggcgacccggtcgtcctgccccgcaccagcgagggcctctacctgctccagcgcgtccgt
gacgaggcgcaccgcttcgcgatcacctaccagcgcaccaaacgcgccaagcgtttccgg
gcgagccccctggatgacgtggcgggtctcggcgagactcgcaaacaggcgctgatcaag
catttcggctcagtgaagaagctgcgatccgcgaccatcgaccagatctgtgaggttccg
ggcatcggccgcaagacggccgagacgatcgccgtggccttcgcccaggcggccccggcc
gtccccgccgtgaacacggcgactggagagatcatggaagacgaggaacccgggacgacg
gcgggttcctcccaggagcccgtgtccgcgggcacctcggacgagcgacgggggcaggag
acatga

DBGET integrated database retrieval system