KEGG   Streptomyces avermitilis: SAVERM_6299
Entry
SAVERM_6299       CDS       T00126                                 
Symbol
secG
Name
(GenBank) putative preprotein translocase SecG subunit
  KO
K03075  preprotein translocase subunit SecG
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_6299 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_6299 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_6299 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_6299 (secG)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_6299 (secG)
SSDB
Motif
Pfam: SecG Sec61_beta DUF2254 DUF6338 Syndecan
Other DBs
NCBI-ProteinID: BAC74010
NITE: SAV6299
UniProt: Q829W0
Position
7562893..7563207
AA seq 104 aa
MSTHRAHRKSFGPRCRPSSSEEVGPAVVLGFSIALIVFSLLLMLLVLMHKGKGGGLSDMF
GGGMQSSVGGSSVAERNLDRITVVIGLLWFASIVVLGILMKVNR
NT seq 315 nt   +upstreamnt  +downstreamnt
gtgagcacgcacagagctcaccggaaaagcttcggcccccgttgtcgtccatccagttcc
gaggaagttggtccagccgtggttttggggttctcgatcgccctgatcgtcttcagcctg
ctgctgatgctgctggtgctgatgcacaaggggaagggcggcggcctctccgacatgttc
ggtggcggcatgcagtcgtccgtcggcggctcctcggtcgccgagcgcaacctcgaccgg
atcaccgtggtgatcggtctgttgtggttcgcgtccattgtcgtgctcggcatcctgatg
aaggtcaacaggtag

DBGET integrated database retrieval system