KEGG   Streptomyces avermitilis: SAVERM_6455
Entry
SAVERM_6455       CDS       T00126                                 
Symbol
moaA3
Name
(GenBank) putative molybdenum cofactor biosynthesis protein A
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
sma  Streptomyces avermitilis
Pathway
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01240  Biosynthesis of cofactors
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAVERM_6455 (moaA3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_6455 (moaA3)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     SAVERM_6455 (moaA3)
SSDB
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_12 Fer4_14 Radical_SAM_2
Other DBs
NCBI-ProteinID: BAC74166
NITE: SAV6455
UniProt: Q829F6
Position
7733782..7734813
AA seq 343 aa
MSEECDPHRGEGARVLIDTYGRVATDLRVSLTDRCNLRCTYCMPEEGLQWLAKPDLLTDD
EIVRLIDIAVTRLGITEVRFTGGEPLLRPGLVGIVERVAALASRPQTSLTTNGIGLSRTA
TALKAAGLDRVNVSLDTLRPDVFKTLTRRDRHKDVIAGLEAARDAGLTPVKVNTVLMPGL
NADEAPDLLAWAVAHDYELRFIEQMPLDAQHGWKREGMVTAGDILASLRTRFELSEEGAD
ERGSAPAERWLVDGGPHRVGVIASVTRPFCAACDRTRLTADGQIRTCLFATEETDLRAAL
RSDAPDEEIARIWRLAMWGKKAGSGLDDPSFLQPERPMSAIGG
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtgtccgaggaatgtgatccgcatcgaggggagggggcccgcgtgctcatcgacacctac
ggccgggtggcaaccgacctgcgcgtctcactgaccgaccgctgcaatctgcggtgcacg
tactgcatgcccgaagaaggcctgcagtggctggccaagcccgatctgctcacggacgac
gagatcgtccgtctgatagacatcgccgtcacccggctcggcatcaccgaggtccgcttc
accggcggcgagcccctgctgcgccccggcctggtcggcatcgtggagcgggtcgccgcc
ctcgcctcacgcccccagacgtccctgaccaccaacggcatcggcctcagccgcaccgcg
accgccctgaaggcggcgggcctggaccgcgtcaatgtctccctcgacaccctccgcccc
gacgtcttcaagaccctcacccgccgtgaccgtcacaaggacgtcatcgcgggcctcgaa
gcggcccgcgacgccggcctgacccccgtcaaggtcaacacggtcctgatgccgggactg
aacgcggacgaggcccccgacctgctggcctgggccgtggcgcacgactacgagctgcgt
ttcatcgagcagatgcccctggacgcccagcacggctggaagcgcgagggcatggtcacc
gcgggcgacatcctcgcctcgctgcgtacgcgtttcgagctctcggaggagggcgccgac
gagcgcggctccgccccggccgagcgctggctcgtcgacggcggcccgcaccgcgtgggc
gtgatcgcctcggtcacccgcccgttctgcgcggcctgcgaccgtacgcgcctgacggcc
gacggccagatacgcacatgtctgttcgccaccgaggagaccgacctgcgcgcggccctg
cgctcggacgcccccgacgaggagatcgcccgtatctggcggctcgcgatgtggggcaag
aaggcgggctcgggcctggacgatccctcgttcctccagccggagcggccgatgtcggcg
atcggcggctga

DBGET integrated database retrieval system