KEGG   Streptomyces avermitilis: SAVERM_6507
Entry
SAVERM_6507       CDS       T00126                                 
Symbol
ald
Name
(GenBank) putative L-alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00430  Taurine and hypotaurine metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_6507 (ald)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAVERM_6507 (ald)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     SAVERM_6507 (ald)
SSDB
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 2-Hacid_dh_C Pyr_redox Shikimate_DH 3HCDH_N Pyr_redox_2 NAD_binding_2 GIDA THF_DHG_CYH_C NAD_binding_8 Pyr_redox_3 FAD_oxidored HI0933_like
Other DBs
NCBI-ProteinID: BAC74218
NITE: SAV6507
UniProt: Q829A4
Position
7795945..7797060
AA seq 371 aa
MKVGIPREVKNNEFRVAITPAGVHELVRYGHQVFIEQNAGVGSSITDDEYVSAGAQILPT
ADEVWAIADLLLKVKEPIAEEYHRLRKDQTLFTYLHLAASQECTDALLESGTTAIAYETV
ELPSRALPLLAPMSEVAGRLAPQVGAYHLMRANGGRGVLPGGVPGVLPAKAVVIGGGVSG
WNAAQIAIGMGFQVTLLDRDINKLKEADKIFGTKIQTVVSNAFELEKACLEADLVIGAVL
IPGAKAPKLVTNELVSRMKPGSVLVDIAIDQGGCFEDSRPTTHAEPTFRVHNSVFYCVAN
MPGAVPNTSTYALTNATLPYILELANRGWAEALRRDPALAKGLNTHDGKVVYREVAESLG
LEYVEIESLLG
NT seq 1116 nt   +upstreamnt  +downstreamnt
gtgaaggtcggcatcccccgcgaggtcaagaacaacgagttccgggtggccatcaccccc
gcaggcgtgcacgagctggtgcgctacggccaccaggtcttcatcgagcagaacgccggc
gtcggctcctcgatcacggacgacgagtacgtctccgccggcgcgcagatccttccgacc
gccgacgaggtctgggccatcgccgacctgctgctcaaggtcaaggagcccatcgccgag
gagtaccaccgcctccgcaaggaccagacgctcttcacctacctgcacctggccgcctcc
caggagtgcacggacgccctcctggagtccggcaccacggcgatcgcgtacgagaccgtc
gagctgcccagccgcgccctgccgctgctggccccgatgtccgaggtcgcgggccggctc
gccccgcaggtcggcgcctaccacctgatgcgcgccaacggcggccgtggtgtcctgccg
ggcggtgtcccgggtgtgctccccgccaaggcggtcgtcatcggcggcggcgtctccggc
tggaacgccgcgcagatcgccatcggcatgggcttccaggtgaccctgctcgaccgtgac
atcaacaagctcaaggaggcggacaagatcttcggtacgaagatccagaccgtcgtctcc
aacgccttcgagctggagaaggcctgcctcgaggccgacctcgtcatcggcgcggtgctg
atcccgggtgcgaaggccccgaagctggtcaccaacgagctggtctcgcggatgaagccc
ggaagtgtccttgtcgacatcgcgatcgaccagggcggctgcttcgaggactcccgtccg
accacgcacgccgagccgaccttccgggtccacaactcggtcttctactgcgtcgccaac
atgcccggcgccgtccccaacacctcgacgtacgcgctgaccaacgccacgctgccgtac
atcctggaactggcgaaccgcggctgggccgaggcgctgcgccgtgaccccgcgctcgcc
aagggcctcaacacccatgacggcaaggtcgtttaccgcgaggtcgcggagtcgctcggc
ctggagtacgtcgagatcgagtccctgctcggctga

DBGET integrated database retrieval system