KEGG   Streptomyces avermitilis: SAVERM_6521
Entry
SAVERM_6521       CDS       T00126                                 
Symbol
tyrA
Name
(GenBank) putative prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00401  Novobiocin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_6521 (tyrA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SAVERM_6521 (tyrA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SAVERM_6521 (tyrA)
SSDB
Motif
Pfam: PDH_N PDH_C 3HCDH_N F420_oxidored DAO ACT PEP_mutase AlaDh_PNT_C FAD_binding_3 FAD_binding_2 Sacchrp_dh_NADP 2-Hacid_dh_C CoA_binding_2 Pyr_redox UDPG_MGDP_dh_N GIDA
Other DBs
NCBI-ProteinID: BAC74232
NITE: SAV6521
UniProt: Q828Z0
Position
7808035..7809129
AA seq 364 aa
MRTALVIGTGLIGTSAALALAGRGVVVHLADHDPEQARTAAALGAGTDEAPEKPVDLVIV
AAPPAHVAATLADAMRRGLGRGYLDVASVKGGPRRELEALGLDRSVMSTYIGSHPMSGRE
KSGPLAATGDLFEGRPWVLTPTRDTDTEVLNLALELVSHCRAVPVVMDADAHDRAVALVS
HMPHLVSSMVAARLENAEETAVRLCGQGIRDVTRIAASDPRMWIDILSANPGPVADLLTD
VSADLDETVRALRSLQSSDEAKRRAGATGIEDVLRRGNAGQVRVPGKHGSAPRTYETVAV
LIDDQPGQLARIFADAGLAGVNIEDVRIEHATGQQAGLVQLMVEPKEAPVLSAALRERGW
ALRQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
gtgaggaccgcactcgtcatcgggaccgggctgatcggtacgtcggcggccctggcgctg
gccgggcgcggcgtcgtcgtgcacctcgccgaccacgacccggaacaggcgcgtacggcg
gcggcgctcggcgccggcacggacgaggcgcccgaaaagcccgtcgacctcgtcatcgtg
gcggccccgcccgcgcacgtggcggccaccctcgccgacgccatgcggcgtggcctgggg
cgcggctacctcgacgtggccagtgtcaagggcggtccgcgccgcgagctggaggcgctc
ggcctcgaccggtccgtcatgtcgacgtacatcggttcgcaccccatgtcgggccgcgag
aagtcgggccccctcgccgcgaccggcgacctcttcgaggggcgcccctgggtcctgacg
ccgacccgggacacggacaccgaggtgctgaacctggccctggagctggtgtcgcactgc
cgtgccgtgccggtcgtcatggacgccgacgcccacgaccgggccgtggcgctcgtctcg
cacatgccgcacctggtgtccagcatggtcgccgcccggctggagaacgccgaggagacg
gccgtacgcctgtgcggccagggcatccgggacgtgacccgcatcgccgcgtccgacccc
cggatgtggatcgacatcctgtccgcgaacccgggcccggtcgccgacctgctcaccgac
gtgtccgccgacctcgacgagacggtgcgggccctgcgctccctccagtcctccgacgag
gcgaagcggcgtgcgggcgccaccggcatcgaggacgtcctgcgccggggcaacgcgggg
caggtccgggtgcccggcaagcacggcagcgcgccgcggacctacgagaccgtggccgtc
ctcatcgacgaccagccgggccagctggcccgtatcttcgcggacgcggggctggccggg
gtcaacatcgaggacgtacgcatcgagcacgcgaccgggcagcaggcgggtctggtccag
ctgatggtggagccgaaggaggcgccggtactgagcgcggcgctgcgggaacgaggctgg
gcgttgcggcagtag

DBGET integrated database retrieval system