KEGG   Streptomyces avermitilis: SAVERM_6587
Entry
SAVERM_6587       CDS       T00126                                 
Symbol
hmgA
Name
(GenBank) putative homogentisate 1,2-dioxygenase
  KO
K00451  homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00350  Tyrosine metabolism
sma00643  Styrene degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_6587 (hmgA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SAVERM_6587 (hmgA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     SAVERM_6587 (hmgA)
SSDB
Motif
Pfam: HgmA_N HgmA_C
Other DBs
NCBI-ProteinID: BAC74298
NITE: SAV6587
UniProt: Q828S5
Position
complement(7883693..7885009)
AA seq 438 aa
MSGDARKTAEGLAHLTGFGNEHASEAVPGALPEGRNSPQRAPLGLYAEQLSGSAFTEPRA
HNRRSWLYRIRPSAAHPPFTRADNGAIRTAPFTETAPDPNRLRWNPLPEPPAGTDFVGGL
WTLGGNGDATQRTGMAVHLYHANSSMDRVFSDADGELLIVPERGGLLLRTEFGLLHAEPG
QVALVPRGVRFRVDLLDESARGYVCENYGAPFQLPDLGPIGANGLAAARDFKAPVAAYED
VEGPVEVVNKFCGNLWTATYDHSPLDVVAWHGNHVPYTYDLRRFNVLGTISYDHPDPSIF
TVLTSPSDTPGLAGVDFVVFAPRWLVGEDTFRPPYFHRNVMSEYMGLIEGAYDAKAAGFV
PGGGSLHNMMSAHGPDRETFDRASAAELRPQKIDDGLAFMFETRWPVTATAQAARAEHLQ
PAYDDVWQGLQRHFRPSD
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagcggggacgcacggaagaccgccgaaggactggcccatctcaccgggttcggcaac
gaacacgcctcggaagcggtccccggcgccctccccgagggccgcaactccccgcagcgc
gccccgctcggcctgtacgcggagcagctcagcggctcggcgttcaccgagcccagggca
cacaaccggcgctcgtggctgtaccggatccgcccctcggccgcgcaccccccgttcacc
cgcgcggacaacggcgcgatccgcaccgcccccttcacggagacggcgcccgacccgaac
cggctgcgctggaacccgctgcccgagccccccgccgggacggacttcgtcggcggcctg
tggaccctcggcggcaacggcgacgccacccagcgcaccggcatggccgtgcacctgtat
cacgccaactcctcgatggaccgcgtcttcagcgacgccgacggggagctgctgatcgtg
ccggagcgcggcggactgctcctgcgcaccgagttcgggctgctgcacgcggagccgggc
caggtcgcgctggtcccccgcggcgtccgcttccgcgtggacctcctcgacgagtccgcc
cggggctacgtctgcgagaactacggcgcccccttccagctccccgacctcggcccgatc
ggcgccaacggactcgcggccgcccgggacttcaaggctcccgtggccgcgtacgaggac
gtcgagggccccgtcgaggtggtgaacaagttctgcggcaacctctggacggcgacatac
gaccactcgcccctggatgtggtcgcctggcacggcaaccacgtgccgtacacctacgac
ctgcgccgtttcaatgtgctgggcaccatcagctacgaccacccggacccgtcgatcttc
acggtgctgacctcaccgtccgacaccccggggctcgccggcgtcgacttcgtggtgttc
gcgccgcgctggctggtgggtgaggacacgttccggccgccgtacttccaccggaacgtg
atgagcgagtacatggggctcatcgagggcgcctacgacgccaaggcggccggtttcgtt
cccggtggggggtcgctgcacaacatgatgtcggcgcacgggcccgaccgggagaccttc
gaccgggcgagcgccgccgagctgcggccgcagaagatcgacgacggtctcgcgttcatg
ttcgagacgcgctggccggtgaccgcgacggcccaggcggcccgcgccgagcacctccaa
cccgcgtacgacgacgtgtggcaggggctccagcgccacttccgtccgtcggactga

DBGET integrated database retrieval system