KEGG   Streptomyces avermitilis: SAVERM_6677
Entry
SAVERM_6677       CDS       T00126                                 
Name
(GenBank) putative AAA-family ATPase
  KO
K13527  proteasome-associated ATPase
Organism
sma  Streptomyces avermitilis
Pathway
sma03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    SAVERM_6677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sma03051]
    SAVERM_6677
Proteasome [BR:sma03051]
 Prokaryotic proteasome
  Bacterial regulatory particles
   SAVERM_6677
SSDB
Motif
Pfam: AAA Prot_ATP_OB_N Prot_ATP_ID_OB AAA_16 AAA_22 RuvB_N RNA_helicase AAA_5 Cep57_CLD_2 TIP49 ATG16 ATPase_2 AAA_2 AAA_25 Mg_chelatase Zeta_toxin AAA_33 SlyX AAA_7 ABC_tran AAA_23 CENP-F_leu_zip AAA_14 HAP1_N Rad17 AAA_18 TolA_bind_tri NACHT NTPase_1 Wtap FPP AAA_28 Lzipper-MIP1 HOOK IstB_IS21 Parvo_NS1 NB-ARC AAA_3 TsaE Fez1
Other DBs
NCBI-ProteinID: BAC74388
NITE: SAV6677
UniProt: Q828J2
Position
7988428..7990194
AA seq 588 aa
MAAHDDDMNRGIRPGRGSDDPAGQIAYLEQEIAVLRRKLADSPRHTRILEERIVELQTNL
AGVSAQNERLANTLREARDQIVALKEEVDRLAQPPAGFGVFLTANEDGTADIFTGGRKLR
VNVSPSVELEELRRGQELMLNEALNVVEAMEYESVGDIVTLKEILEDGERALVVGHTDEE
RVVRLAEPLLDVTIRPGDALLLEPRSGYVYEVVPKSEVEELVLEEVPDIGYEQIGGLGNQ
IEMIRDAVELPYLYPDLFKEHELRPPKGVLLYGPPGCGKTLIAKAVANSLAKKVAEVTGQ
ATGKSFFLNIKGPELLNKYVGETERQIRLVFQRAREKASEGTPVIVFFDEMESLFRTRGS
GVSSDVENTIVPQLLAEIDGVEGLQNVVVIGASNREDMIDPAILRPGRLDVKIKIERPDA
EAAKDIFGKYLTERLPLHTEDVGEHGGDRSATVHGMIQTAVEQMYAESEENRFLEVTYAN
GDKEVLYFKDFNSGAMIENIVGRAKKMAIKDFLEHSQKGLRVSHLLQACVDEFKENEDLP
NTTNPDDWARISGKKGERIVYIRTLITGKQGADTGRSIDTVANTGQYL
NT seq 1767 nt   +upstreamnt  +downstreamnt
gtggcagcccacgacgacgacatgaaccgcggcatccgcccgggaagagggtccgacgac
cccgccgggcagattgcctaccttgagcaggagatcgccgtcctgcgacgcaagctcgcc
gactctccgcgacacacgaggattctcgaagagcggatcgtcgagctgcagaccaatctg
gccggcgtgtccgcacagaacgagcggctcgccaacacgctccgtgaggcccgcgaccag
atcgtggccctcaaggaagaggtcgaccggctcgcacagccaccggccggcttcggtgtc
ttcctcacggcgaacgaggacggcacggcggacatcttcaccgggggccgcaaactccgg
gtgaacgtcagccccagcgtggagctcgaagagctcaggcgcggccaggaactgatgctc
aacgaagccctcaacgtggtcgaggccatggagtacgagagcgtcggcgacatcgtcacc
ctcaaggagatcctcgaggacggcgagcgcgccctcgtggtggggcacaccgacgaggaa
cgggtggtacggctcgccgagccgctgctggacgtcaccatccgccccggcgacgccctg
ctgctcgaaccccgctccggctacgtctacgaagtcgtaccgaagagcgaggtcgaggaa
ctcgtcctcgaagaggtcccggacatcggctacgagcagatcggcggtctgggcaaccag
atcgagatgatccgcgacgcggtcgagctcccctacctctaccccgacctcttcaaggag
cacgaactgcggccacccaagggtgtcctgctgtacgggcctccaggatgcggaaagacg
ctcatcgccaaggccgtcgccaactcgctggccaagaaggtcgccgaggtcaccggacag
gccacgggcaagagcttcttcctcaacatcaagggccccgagctcctgaacaagtacgtc
ggcgagaccgagcggcagatccgcctcgtcttccagcgtgctcgtgagaaggccagcgag
ggcacaccggtcatcgtcttcttcgacgagatggagtccctcttccgcacccgcggctcg
ggcgtcagctcggacgtggagaacaccatcgtcccgcagctcctcgccgagatcgacggt
gtggaaggcctgcagaacgtggtcgtgatcggcgcctccaaccgagaggacatgatcgac
cccgccatcctgcgccccggacgtctcgatgtgaagatcaagatcgagcggccggacgcc
gaggcggcgaaggacatcttcggcaagtacctcaccgagcgtctccccctgcacaccgag
gacgtgggagagcacggcggggaccggtcggccaccgtccacggcatgatccagaccgcc
gtggaacagatgtacgccgaatccgaggagaaccgcttcctggaggtcacctacgccaac
ggagacaaggaagtcctctacttcaaggacttcaactccggcgccatgatcgaaaacatc
gtcgggcgcgccaagaagatggcgatcaaggacttcctcgagcacagccagaagggcctg
agggtctcccacctcctccaagcgtgcgtggacgagttcaaggagaacgaggacctgcca
aacaccacgaacccggacgactgggcccgaatctccggaaagaagggcgaacggatcgta
tacatccgtaccctcatcaccggaaagcagggcgcggacacagggcgctccatcgacaca
gtggccaacaccggtcagtacctgtag

DBGET integrated database retrieval system