KEGG   Streptomyces avermitilis: SAVERM_6834
Entry
SAVERM_6834       CDS       T00126                                 
Symbol
ruvA
Name
(GenBank) putative Holliday junction DNA helicase subunit B
  KO
K03550  holliday junction DNA helicase RuvA [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_6834 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6834 (ruvA)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_6834 (ruvA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAVERM_6834 (ruvA)
    RecFOR pathway proteins
     SAVERM_6834 (ruvA)
SSDB
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH Phage_TAC_11 HHH_8 5_3_exonuc
Other DBs
NCBI-ProteinID: BAC74545
NITE: SAV6834
UniProt: Q820F4
Position
8157176..8157787
AA seq 203 aa
MIAFVSGPVAALAPDSAVVEVGGIGIAVQCTPNTLSGLRMGREAKLATSLVVREDSLTLY
GFVDDDERQVFELLQTASGVGPRLAQAMLAVHTPDALRRAVSTGDEKALVAVPGIGKKGA
QKLLLELKDRLGEPLGTGGPAIGRAVTTGWREQLHAALIGLGYATREADEAVAAVAPQAE
AAGGTPQVGQLLKAALQTLNRTR
NT seq 612 nt   +upstreamnt  +downstreamnt
atgatcgccttcgtcagcggcccggtcgccgccctcgcccccgactccgccgtggtcgag
gtcggcggcatcggcatcgccgtccagtgcacccccaacacgctctccgggctgcgcatg
ggccgggaggccaagctcgccacctccctcgtcgtacgcgaggactcactgaccctgtac
ggcttcgtggacgacgacgagcgccaggtcttcgaactgctgcagaccgcgagcggtgtc
ggaccgcgtctcgcccaggcgatgctcgccgtgcacacgcctgacgcgctgcgccgagcc
gtctccaccggcgacgagaaggccctcgtcgccgttcccggcatcggcaagaagggcgcc
cagaagctgctgctggagctgaaggaccggctcggcgagcccctcggcaccggtggcccg
gcgatcggcagggccgtcaccaccggctggcgcgagcagctgcacgccgcgctgatcggc
ctcgggtacgcgacccgggaggccgacgaggcggtcgccgcggtcgccccccaggccgag
gccgccgggggcacaccccaggtgggacagctgctgaaggccgccctgcagaccctgaac
cggacccgctga

DBGET integrated database retrieval system