KEGG   Streptomyces avermitilis: SAVERM_6835
Entry
SAVERM_6835       CDS       T00126                                 
Symbol
ruvB
Name
(GenBank) putative Holliday junction DNA helicase subunit A
  KO
K03551  holliday junction DNA helicase RuvB [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_6835 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6835 (ruvB)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_6835 (ruvB)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAVERM_6835 (ruvB)
    RecFOR pathway proteins
     SAVERM_6835 (ruvB)
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 AAA_16 TIP49 Mg_chelatase Sigma54_activat DUF815 AAA_3 AAA_14 TsaE RNA_helicase Sigma54_activ_2 Zeta_toxin AAA_28 NTPase_1 AAA_18 AAA_19
Other DBs
NCBI-ProteinID: BAC74546
NITE: SAV6835
UniProt: Q820F3
Position
8157959..8159029
AA seq 356 aa
MNWDDTTDATADERLVGASADREDQAVEAALRPKDLDEFIGQEKVREQLDLVLRAARARG
ATSDHVLLSGAPGLGKTTLSMIIAAEMGAPIRITSGPAIQHAGDLAAILSSLQEGEVLFL
DEIHRMSRPAEEMLYMAMEDFRVDVIVGKGPGATAIPLELPPFTLVGATTRAGLLPPPLR
DRFGFTAHMEFYEPHELERVIHRSAGLLDVEIDSRGAAEIAGRSRGTPRIANRLLRRVRD
YAQVKADGVITREIAAAALKVYEVDARGLDRLDRGVLEALLKLFGGGPVGLSTLAVAVGE
ERETVEEVAEPFLVREGLLARTPRGRVATPAAWAHLGLTPPPRATGGNGQGDLFGA
NT seq 1071 nt   +upstreamnt  +downstreamnt
gtgaactgggacgacacgaccgacgcgaccgccgacgagcggctcgtcggcgcgtccgcc
gaccgtgaggaccaggccgtcgaggccgccctgcggcccaaggacctggacgagttcatc
ggccaggagaaggtccgcgagcaactcgacctcgtcctgcgggccgcacgcgcgcgtggc
gcgacctccgaccacgtactgctctccggcgctcccggcctcggcaagaccaccctctcc
atgatcatcgcggccgagatgggcgccccgatccgcatcaccagcggccccgccatccag
cacgccggcgacctcgcggcgatcctctcctccctccaggagggcgaggtcctcttcctc
gacgagatccaccgcatgtcccggcccgccgaggagatgctgtacatggccatggaggac
ttccgcgtcgacgtcatcgtcggcaagggccccggcgccaccgccatccccctcgaactg
cccccgttcaccctggtcggcgccaccacgcgcgcgggtctgctgccgcccccgctgcgt
gaccgcttcggcttcacggcacacatggagttctacgagccccacgagctggagcgcgtg
atccaccgctcggccggcctgctcgacgtcgagatcgactctcgtggcgcggccgagatc
gcgggccgctcccggggcacgccccgtatcgccaaccgtctgctgcgccgcgtacgggac
tacgcccaggtcaaggcggacggcgtcatcacccgtgagatcgcggcggccgcgctgaag
gtctacgaggtggacgcccgcggcctcgaccgcctggaccgcggcgtcctcgaagccctg
ctgaagctgttcggcggcggcccggtcggcctgtccacgctcgccgtcgcggtgggggag
gagcgcgagaccgtcgaggaggtcgccgagcccttcctggtacgggagggactgctcgcc
cgcacaccccgtggccgggtcgcgacaccggccgcctgggcccacctcggcctcaccccg
ccccctcgggctaccgggggaaacggacaaggggacctgttcggggcgtga

DBGET integrated database retrieval system