KEGG   Streptomyces avermitilis: SAVERM_6836
Entry
SAVERM_6836       CDS       T00126                                 
Symbol
yajC
Name
(GenBank) putative preprotein translocase YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_6836 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_6836 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_6836 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_6836 (yajC)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_6836 (yajC)
SSDB
Motif
Pfam: YajC
Other DBs
NCBI-ProteinID: BAC74547
NITE: SAV6836
UniProt: Q827T8
Position
8159193..8159696
AA seq 167 aa
MNTLTLLPFIVLIGAMFLMTRSAKRKQQQAASMRNEMQPGAGVRTIGGLYATVKEVNEDT
VLLDAAPGVDLLFAKNSIGAVLTDDEYNRIVHGIEHDLKTDGTVVPDDASSLTETDEPAA
DASSDASDDKPIDLGKKDAADDTADEPGKAKSDEAEPKKTDGETDAK
NT seq 504 nt   +upstreamnt  +downstreamnt
gtgaataccttgaccctcctcccgttcatcgtgcttatcggggccatgttcctgatgacc
cgctcggccaagcgcaagcagcagcaggccgcgtcgatgcgtaatgagatgcagcccggc
gccggcgtccgcacgatcgggggcctgtacgcgacggtgaaggaggtcaacgaggacacg
gtcctccttgacgccgccccgggcgtcgacctgctcttcgcgaagaactccatcggcgcc
gtcctgaccgacgacgagtacaaccgcatcgtccacggcatcgagcacgacctgaagacc
gacggcacggtcgtgccggacgacgcctcctccctcaccgagaccgacgagcccgccgcc
gacgcctcttccgacgcctccgacgacaagcccatcgacctcggcaagaaggacgcggcg
gacgacaccgccgacgagccgggcaaggcgaagtccgacgaagcagagccgaagaagacc
gacggcgagaccgacgcgaagtag

DBGET integrated database retrieval system