KEGG   Streptomyces avermitilis: SAVERM_6837
Entry
SAVERM_6837       CDS       T00126                                 
Symbol
secD
Name
(GenBank) putative preprotein translocase SecD subunit
  KO
K03072  preprotein translocase subunit SecD
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_6837 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_6837 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_6837 (secD)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_6837 (secD)
SSDB
Motif
Pfam: SecD_SecF MMPL Sec_GG ACR_tran CheD HHV-5_US34A
Other DBs
NCBI-ProteinID: BAC74548
NITE: SAV6837
UniProt: Q827T7
Position
8159839..8161593
AA seq 584 aa
MAAPKKGRSASAQSRPGRSLALILIAIAALTGGMFASGNTTPRLGIDLAGGTSITLEAKS
GQESAINKTNMNTAVDIMNRRVNGLGVSEAEVQTQGDRNIIVNIPKGTNSEQARKQVGTT
AKLYFRPVLATEVSGAAAASPTPSASNSSSKKATDKATEKATSSGTPSATATSQGRAVTD
ALKDDPTPSASNSASASAKASSSPSPSASSGAEAEAAKLQAAYTALDCRKEGQRAKAGEG
AKPTDTTLACGTNSGGQWQKYVLGPAEVAGTDVKKASAVYDTQSGAGWKVTMDFTSGGSK
KFASITGKLAKNQEPQNQFAIVLDGSVVSDPRVSEALTGGNAEISGSFDQTEAKDLANVL
SYGALPLSFREQSVTTVTAALGGEQLHAGLIAGAIGLALVVIYLVLYYRGLSLIAIASLL
VSAALTYAIMTLLGPTIHFALNLPAVCGAIVAIGITADSFIVFFERIRDEIREGRTLRPA
VERAWPRARRTILVSDFVSFLAAAVLFIVTVGKVQGFAFTLGLTTVLDVVVVFLFTKPLM
TILARKQFFANGHSWSGLDPKRLGAQPPLRRTRRPSAPADPKEA
NT seq 1755 nt   +upstreamnt  +downstreamnt
gtggcagcaccgaagaagggccggagcgcgagcgcccagagcaggccggggcgctcgctg
gccctcatcctgatcgccatcgcggcgctcaccgggggaatgttcgcctccggaaacacc
actccgcgtctcggcatcgacctcgccggcggaacgagcatcacgctcgaggcgaagagc
ggccaggaatccgcgatcaacaagaccaacatgaacaccgcggtcgacatcatgaaccgc
cgtgtcaacggtcttggcgtttcggaggcggaggtccagacccagggcgatcgcaacatc
atcgtcaacatccccaagggcacgaactccgagcaggcccggaagcaggtcggcaccacc
gccaagctctacttccgccccgtcctcgcgaccgaggtctccggtgcggccgcggccagc
ccgacgcccagcgcctccaacagctcctccaagaaggccaccgacaaggccaccgagaag
gcgacgtcctccggcaccccgtcggccaccgccacctcgcagggccgcgcggtcaccgac
gcgctgaaggacgaccccacgccgtccgcgagcaactcggcgtccgcctccgccaaggca
tcctccagcccctccccgtccgcgagcagtggcgccgaggccgaggccgccaagctccag
gccgcgtacaccgcgctcgactgccgcaaggaggggcagcgcgccaaggccggtgagggc
gccaagcccaccgacaccaccctggcctgcggcacgaactcggggggccagtggcagaag
tacgtgctcggcccggccgaggtcgccggcaccgacgtgaagaaggcctcggcggtctac
gacacccaaagtggcgcgggctggaaggtcaccatggacttcacgtccggggggtccaag
aagttcgcgagcatcacgggcaagctggcgaagaaccaggaaccgcagaaccagttcgcc
atcgtcctcgacggctcggtcgtctccgacccgcgtgtcagcgaggcgctgaccggcggt
aacgcggagatctccggcagcttcgaccagacggaggccaaggacctggccaacgtgctg
tcctacggcgcgctcccgctctcgttccgggagcagagcgtcaccaccgtcaccgccgcg
ctcggcggcgagcagctgcacgccggcctgatcgcgggcgcgatcggcctggccctggtc
gtcatctacctggtgctctactaccggggcctgtcgctcatcgccatcgcctcgctgctg
gtctccgcggccctgacctacgcgatcatgaccctgctcggcccgacgatccacttcgcg
ctgaacctgccggcggtctgcggtgcgatcgtcgccatcggtatcacagcggactcgttc
atcgtgttcttcgaacgcatcagggacgagatccgtgagggccgtacgctgcggcccgcc
gtcgagcgagcctggccgcgtgcccggcgcaccatcctggtctccgacttcgtgtcgttc
ctcgccgccgcggtgctgttcatcgtgaccgtcggcaaggtccagggcttcgcgttcacg
ctgggtctgaccaccgtgctcgacgtggtcgtcgtcttcctcttcaccaagccgctgatg
acgatcctcgcccgcaagcagttcttcgcgaacggtcacagctggtccggcctcgacccg
aagcgcctcggtgcccagccgccattgcggcgcacccgacgtccttccgcccccgccgac
ccgaaggaggcgtga

KEGG   Streptomyces avermitilis: SAVERM_6838
Entry
SAVERM_6838       CDS       T00126                                 
Symbol
secF
Name
(GenBank) putative preprotein translocase SecF subunit
  KO
K03074  preprotein translocase subunit SecF
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_6838 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_6838 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_6838 (secF)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_6838 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG
Other DBs
NCBI-ProteinID: BAC74549
NITE: SAV6838
UniProt: Q827T6
Position
8161595..8162701
AA seq 368 aa
MSKLGNLGARLHRGEVGYDFVGNRKIWYGISILITITAILGLTVRGLNMGIEFQGGAVFT
TPKTSVSVSQAERYAEEASGHDAIVQKLGSGGLRVQIAGVDTGKSDQIKAELSQNLKVDS
EKINADLVGPSWGEQIANKAWQGLVIFMILVVIYLAIAFEWRMAVAALVALIHDITITVG
IYALVGFEVTPGTVIGLLTILGYSLYDTVVVFDSLKEQTKDLTKQTRWTYSDVANRSINS
TLVRSINTTVVALLPVAGLLFIGGGVLGAGTLNDISLSLFVGLAAGAYSSIFIATPLVAD
LKEREPQMKALRKRVLAKRAQAAAKGEDAEVVGQSCDEPDDAAPAVVGPRNQPASRNRGR
GRPSGKRR
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtcgaagctcggcaacctcggcgcccggctccaccgaggcgaggtcggctacgacttc
gtcggcaaccgcaagatctggtacggcatctcgatcctgatcaccatcacggccatcctc
ggcctgacggtgcgcggcctgaacatgggcatcgagttccagggcggagcggtcttcacc
acccccaagaccagcgtctccgtgtcgcaggccgagaggtacgcggaggaggcgtccggc
cacgacgcgatcgtgcagaagctcggctcgggcggtctgcgcgtgcagatcgccggtgtg
gacaccggcaagtccgaccagatcaaggccgagctctcccagaacctgaaggtcgactcg
gagaagatcaacgccgacctggtcggccccagctggggtgagcagatcgccaacaaggcc
tggcaaggcctggtgatcttcatgatcctggtcgtgatctacctggcgatcgccttcgag
tggcggatggcggtcgcggccctggtcgcgctgatccacgacatcaccatcacggtcggc
atctacgccctcgtcggcttcgaggtgacgcccggtacggtcatcggtctgctcacgatc
ctcggttactcgctctatgacacggtcgtcgtcttcgacagcctcaaggagcagacgaag
gacctcaccaagcagactcgctggacctacagcgatgtcgccaaccgctcgatcaacagc
actctggtccgctccatcaacaccacggtggtcgcgcttctgccggtcgcgggcctgctg
ttcatcggcggtggcgtgctcggcgcgggcacgctcaacgacatctcgctgtcgctgttc
gtcggtctcgcggccggcgcgtactcctcgatcttcatcgccacgccgctcgtcgccgac
ctcaaggagcgcgagccgcagatgaaggccctcaggaagcgcgtcctggccaagcgggcc
caggccgccgccaagggcgaggacgccgaggtcgtcggtcagtcctgcgacgagccggac
gacgccgcccccgcggtcgtgggtccgcgcaaccagcccgcgtcccgcaaccggggccgc
ggccgaccctcggggaagcgccgatga

DBGET integrated database retrieval system