KEGG   Streptomyces avermitilis: SAVERM_6877
Entry
SAVERM_6877       CDS       T00126                                 
Symbol
fmt
Name
(GenBank) putative methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00670  One carbon pool by folate
sma00970  Aminoacyl-tRNA biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_6877 (fmt)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAVERM_6877 (fmt)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     SAVERM_6877 (fmt)
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-ProteinID: BAC74588
NITE: SAV6877
UniProt: Q827P7
Position
8207585..8208517
AA seq 310 aa
MKLVFAGTPEVAVPALDALIASGRHEVAAVVTRPDAPAGRGRRLVASPVAQRAEEAGIEV
LKPVKPRDEEFLARLREIAPDCCPVVAYGALLPRVALDIPAHGWVNLHFSLLPAWRGAAP
VQHSIMAGDEITGASTFLIEEGLDSGPVFGTVTEEIRPTDTSGDLLTRLAFAGSGLLVAT
MDGVEEGKLKAVPQPADGITLAPKITVENAHVDWSTPALRVDRVVRGCTPAPGAWTVFRG
ERLKLIQVVPVPERTDLAPGALSVGKNNVYVGTGSYAVELLWVQAQGKKPMRAADWARGV
RITDGEPLGA
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaagctcgtctttgcaggtactcccgaggtcgccgttcccgccctggacgctctgatc
gcctccgggcggcatgaggtggccgccgtcgtgacgcggcccgacgccccggccgggcgg
ggacggcggctggtcgcgagtcccgttgcccagcgggcggaggaggccgggatcgaggtg
ctcaagccggtcaagccgcgggacgaggagttcctggcgcggctgcgggagatcgcgccg
gactgctgtcccgtcgtcgcctacggcgcgctgctgccgcgggtcgccctcgacattccg
gcgcacggctgggtcaatctgcacttctcgctgctgcccgcctggcgcggtgccgctccc
gtgcagcactccatcatggccggggacgagatcaccggagcgtccaccttcctcatcgag
gagggactcgactccgggcccgtcttcggcaccgtcaccgaggagatccggcccaccgac
accagcggcgacctgctcacacggctcgccttcgccggttccgggctgctcgtcgcgacc
atggacggtgtcgaggagggcaagctgaaggccgtgccgcagcccgccgacggcatcact
ctcgcgccgaagatcaccgtcgagaacgcgcacgtcgactggtctacgccggcgctgcgg
gtcgaccgggtggtgcgcgggtgcacgcccgcgcccggtgcctggaccgtgttccgcggc
gagcggctcaagctcatccaggtcgtcccggtgcccgagcggaccgatctcgccccgggc
gcgctgtccgtcggcaagaacaacgtgtacgtcggcaccggttcgtacgccgtcgagctg
ctgtgggtgcaggcccagggcaagaagccgatgcgggccgccgactgggcacgcggcgta
cgcatcacggacggcgagcccctcggcgcgtga

DBGET integrated database retrieval system