KEGG   Streptomyces avermitilis: SAVERM_7214
Entry
SAVERM_7214       CDS       T00126                                 
Symbol
icdA
Name
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00480  Glutathione metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_7214 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAVERM_7214 (icdA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SAVERM_7214 (icdA)
SSDB
Motif
Pfam: IDH
Other DBs
NCBI-ProteinID: BAC74925
NITE: SAV7214
UniProt: Q826H9
Position
complement(8592489..8594708)
AA seq 739 aa
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVAVETRDISLAGRIIALFPEYLEDGR
RIPDALAELGELAKTPEANIIKLPNISASIPQLKAAVAELQEQGYALPDYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTSESKTNVATMGVDD
FRSTEKSAVISEAGSLRIELKGDDGSTTVLRESVPVLPGEVVDASVMHVTALREFLTAQI
ARAKAENVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAQYGETLAAAGLTPNDGLGGI
YKGLESLPEGAAIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEQDTLAVLPDSSYSGVYQVVIDDCRANGAFDPSTMGTVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVDQAGNVVLEQTVGAGDIFRACQTKDAPIKDWVKLAVTRARATGD
PAVFWLDETRAHDAVLIEKVKQYLPEHDTEGLDIRVLSPVEATKFSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQLVRENYLRWD
SLGEFLALASSFEHLATTTGNARAQVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFF
LALYWAQELAGQTDDADLAKAFGPVAETLGTNEQKIVDELISAQGKPADIGGYYQPDPEK
AAAVMRPSATFNEAIASLA
NT seq 2220 nt   +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacgcacactgacgaggccccggccctggcgacgtat
tcgttcttgccggtggtccaggcgtacgcgtcgcaggcgggtgtcgccgtggagacccgt
gacatctcgctggccgggcgcatcatcgccctcttccccgagtacctggaggacggccgg
cgcatccccgacgcgctcgcggagctcggtgagctcgccaagacgcccgaggcgaacatc
atcaagctgccgaacatctcggcgtcgattccgcagctgaaggccgcggtcgccgagctc
caggagcagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgctacgacaaggtcaagggcagcgccgtgaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtgaagaactacgccaagacgcacccgcac
cgcatgggcgcctggacctccgagtccaagacgaacgtcgccaccatgggcgtcgacgac
ttccgctccaccgagaagtccgcggtgatctccgaggccggctcgctccgtatcgagctg
aagggcgacgacggctccaccaccgtcctgcgcgagtccgtacccgtgctgccgggcgag
gtcgtggacgcctccgtcatgcacgtcaccgcgctgcgtgagttcctcaccgcgcagatc
gcccgcgccaaggccgagaacgtgctgttctccgtgcacctcaaggccacgatgatgaag
gtctcggacccgatcgtcttcggtcacgtggtgcgcgccttcttcccgaagacgttcgcg
cagtacggcgagacgctcgccgcggccggcctgaccccgaacgacggtctgggcggcatc
tacaagggcctggagtccctgcccgagggtgccgcgatcaaggcctccttcgacgccgag
ctcgccgagggcccggagctggcgatggtcgactccgacaagggcatcacgaacctgcac
gtcccgtccgacgtcatcgtcgacgcgtccatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggagcaggacaccctcgccgtcctcccggacagcagctac
tccggcgtgtaccaggtcgtcatcgacgactgccgtgccaacggcgccttcgacccgtcg
accatgggcaccgtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcacggtccgcctcgtcgaccaggccggc
aacgtcgtcctggagcagacggtcggcgccggcgacatcttccgcgcctgccagaccaag
gacgccccgatcaaggactgggtcaagctggccgtcacccgcgcccgcgcgaccggcgac
ccggccgtgttctggctggacgagacccgcgcccacgacgccgtgctgatcgagaaggtc
aagcagtacctgccggagcacgacaccgagggcctggacatccgcgtcctgtcccccgtc
gaggcgaccaagttctccgtggagcgcatccgccgcggcgagaacacgatctccgtcacg
ggcaacgtgctgcgtgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcgatcgtcccgctgatggcgggcggcggcctcttcgagacgggcgcc
ggcggctccgccccgaagcacgtccagcagctggtcagggagaactacctgcgctgggac
agcctgggcgagttcctcgcgctggcgtccagcttcgagcacctcgcgacgaccacgggc
aacgcgcgcgcccaggtcctcgccgacaccctcgaccgtgcgacggcgaccttcctcaac
gaggacaagtcgccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttcttc
ctcgccctgtactgggcccaggagctggccgggcagaccgacgacgcggacctcgccaag
gccttcggcccggtcgccgagaccctcggcacgaacgagcagaagatcgtcgacgagctg
atctccgcccagggcaagccggccgacatcggcggctactaccagcccgaccccgagaag
gcggcggcggtcatgcgcccgtcggccacgttcaacgaggcgatcgcgtcgctcgcgtaa

DBGET integrated database retrieval system